Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395S9W0

Protein Details
Accession A0A395S9W0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
80-102EQMCDEFKKKNKPPKGAVIPKIKHydrophilic
NLS Segment(s)
PositionSequence
87-102KKKNKPPKGAVIPKIK
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
Gene Ontology GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MFVKKSPNSHGWVNPRDAEELWRDHFDYFYREYTDNPDKICVFPITCYPDVSGRPHVLLMHERLIEYTNKHEGVEWVTMEQMCDEFKKKNKPPKGAVIPKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.45
4 0.4
5 0.35
6 0.3
7 0.29
8 0.27
9 0.27
10 0.26
11 0.23
12 0.24
13 0.22
14 0.22
15 0.21
16 0.2
17 0.21
18 0.2
19 0.21
20 0.27
21 0.33
22 0.31
23 0.29
24 0.29
25 0.27
26 0.27
27 0.28
28 0.21
29 0.15
30 0.14
31 0.17
32 0.2
33 0.2
34 0.2
35 0.18
36 0.19
37 0.21
38 0.23
39 0.21
40 0.16
41 0.16
42 0.16
43 0.16
44 0.15
45 0.16
46 0.15
47 0.16
48 0.15
49 0.15
50 0.15
51 0.16
52 0.16
53 0.15
54 0.16
55 0.18
56 0.18
57 0.18
58 0.18
59 0.18
60 0.2
61 0.2
62 0.17
63 0.13
64 0.14
65 0.14
66 0.14
67 0.13
68 0.1
69 0.09
70 0.11
71 0.14
72 0.18
73 0.26
74 0.37
75 0.46
76 0.56
77 0.64
78 0.71
79 0.76
80 0.8
81 0.84
82 0.83