Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M516

Protein Details
Accession E2M516    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-85YEQCRIWTSRRAPKRKVREKVLEVYAHydrophilic
NLS Segment(s)
PositionSequence
70-77RAPKRKVR
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR041121  SDH_C  
KEGG mpr:MPER_15501  -  
Pfam View protein in Pfam  
PF18317  SDH_C  
Amino Acid Sequences MIVSTIPATAKHLSSAGGVAIELAYERRMTRLLELAQQKRDQGISWAVIEGIELLLEQGYEQCRIWTSRRAPKRKVREKVLEVYAKSKGSSTVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.12
4 0.09
5 0.08
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.07
15 0.09
16 0.1
17 0.11
18 0.16
19 0.16
20 0.22
21 0.3
22 0.33
23 0.36
24 0.36
25 0.34
26 0.31
27 0.3
28 0.23
29 0.18
30 0.15
31 0.13
32 0.12
33 0.12
34 0.1
35 0.1
36 0.09
37 0.07
38 0.04
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.04
46 0.05
47 0.07
48 0.07
49 0.08
50 0.1
51 0.13
52 0.16
53 0.23
54 0.31
55 0.39
56 0.5
57 0.58
58 0.66
59 0.73
60 0.81
61 0.83
62 0.85
63 0.84
64 0.85
65 0.83
66 0.81
67 0.8
68 0.75
69 0.66
70 0.61
71 0.56
72 0.47
73 0.41
74 0.33