Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395SKT9

Protein Details
Accession A0A395SKT9    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
102-128TSTYLSFRSRRDRRPRNRSRSRATSRAHydrophilic
188-214EEHSVSTPPRRSRRRSQDRYRRDPLMGHydrophilic
221-242RDYSPRDYSPPRRESRRYSRDRBasic
NLS Segment(s)
PositionSequence
110-150SRRDRRPRNRSRSRATSRATSRSKRTRSRTTVQSRDRSRRR
Subcellular Location(s) nucl 10, cyto_nucl 10, cyto 8, mito 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPAIPPSTTIPSDSGHHGLLAVRQNDDSRTSFTAVPTAYKSADTSLHPGAVAGIVLGSVAAFLLLLYIIYMLLHRGPVVRPMGDGASTVASGYPMSTVTGDTSTYLSFRSRRDRRPRNRSRSRATSRATSRSKRTRSRTTVQSRDRSRRRGSPLVSESQASRVIVDPPAPRFVQDSMLSSDNEIVVEEEHSVSTPPRRSRRRSQDRYRRDPLMGDGYRSSRDYSPRDYSPPRRESRRYSRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.21
4 0.2
5 0.19
6 0.22
7 0.27
8 0.23
9 0.22
10 0.23
11 0.25
12 0.26
13 0.29
14 0.26
15 0.23
16 0.25
17 0.26
18 0.26
19 0.25
20 0.28
21 0.24
22 0.24
23 0.23
24 0.22
25 0.2
26 0.19
27 0.19
28 0.17
29 0.19
30 0.19
31 0.21
32 0.2
33 0.2
34 0.19
35 0.18
36 0.16
37 0.13
38 0.11
39 0.06
40 0.04
41 0.03
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.07
64 0.11
65 0.13
66 0.13
67 0.13
68 0.14
69 0.14
70 0.13
71 0.13
72 0.09
73 0.08
74 0.07
75 0.07
76 0.06
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.09
94 0.12
95 0.15
96 0.25
97 0.32
98 0.42
99 0.53
100 0.63
101 0.71
102 0.8
103 0.87
104 0.88
105 0.91
106 0.9
107 0.87
108 0.86
109 0.82
110 0.79
111 0.71
112 0.68
113 0.62
114 0.62
115 0.61
116 0.56
117 0.58
118 0.59
119 0.65
120 0.65
121 0.69
122 0.7
123 0.7
124 0.72
125 0.74
126 0.74
127 0.76
128 0.75
129 0.76
130 0.73
131 0.77
132 0.77
133 0.74
134 0.7
135 0.68
136 0.68
137 0.67
138 0.62
139 0.61
140 0.57
141 0.54
142 0.5
143 0.42
144 0.35
145 0.29
146 0.29
147 0.19
148 0.16
149 0.12
150 0.13
151 0.13
152 0.17
153 0.17
154 0.18
155 0.21
156 0.2
157 0.2
158 0.21
159 0.21
160 0.22
161 0.2
162 0.21
163 0.21
164 0.22
165 0.22
166 0.2
167 0.2
168 0.15
169 0.13
170 0.11
171 0.08
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.09
180 0.15
181 0.22
182 0.3
183 0.4
184 0.49
185 0.57
186 0.68
187 0.77
188 0.82
189 0.86
190 0.89
191 0.9
192 0.91
193 0.93
194 0.89
195 0.83
196 0.73
197 0.65
198 0.59
199 0.58
200 0.49
201 0.42
202 0.38
203 0.36
204 0.37
205 0.36
206 0.34
207 0.28
208 0.34
209 0.36
210 0.4
211 0.44
212 0.46
213 0.53
214 0.59
215 0.65
216 0.68
217 0.72
218 0.74
219 0.76
220 0.8
221 0.82
222 0.84