Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395S0S6

Protein Details
Accession A0A395S0S6    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-40KNRLAARASKARKDRRKKSEAPKDKVAKABasic
NLS Segment(s)
PositionSequence
12-79KNRLAARASKARKDRRKKSEAPKDKVAKADTTRGARKGLLPTSGPRAKMSAKKARKVEKAMAHAMKRK
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MPSVGNPNGPSKNRLAARASKARKDRRKKSEAPKDKVAKADTTRGARKGLLPTSGPRAKMSAKKARKVEKAMAHAMKRKMEAEGEAEMKDAPAVETEEKTEEAEMADIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.44
4 0.5
5 0.57
6 0.59
7 0.59
8 0.66
9 0.72
10 0.77
11 0.8
12 0.82
13 0.82
14 0.86
15 0.87
16 0.89
17 0.89
18 0.9
19 0.86
20 0.85
21 0.81
22 0.75
23 0.7
24 0.61
25 0.55
26 0.47
27 0.46
28 0.42
29 0.41
30 0.41
31 0.38
32 0.37
33 0.32
34 0.32
35 0.3
36 0.26
37 0.23
38 0.2
39 0.2
40 0.27
41 0.29
42 0.26
43 0.22
44 0.22
45 0.24
46 0.29
47 0.35
48 0.38
49 0.42
50 0.49
51 0.55
52 0.62
53 0.65
54 0.64
55 0.64
56 0.61
57 0.59
58 0.6
59 0.59
60 0.54
61 0.54
62 0.53
63 0.47
64 0.42
65 0.38
66 0.32
67 0.27
68 0.24
69 0.21
70 0.21
71 0.2
72 0.18
73 0.18
74 0.16
75 0.15
76 0.13
77 0.1
78 0.07
79 0.07
80 0.1
81 0.11
82 0.12
83 0.14
84 0.16
85 0.17
86 0.17
87 0.16
88 0.14
89 0.12