Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395S109

Protein Details
Accession A0A395S109    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
124-154GYPPEVKPTKPTKAKKAKKEMKEKLNCRQGSHydrophilic
NLS Segment(s)
PositionSequence
130-146KPTKPTKAKKAKKEMKE
Subcellular Location(s) cyto 17, cyto_nucl 13.333, nucl 7.5, mito_nucl 5.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006418  P:tRNA aminoacylation for protein translation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MSSSEPSSKIGLLDTPEEVAKKLKKAVCVPREVEGNGVIAFVEHVILRILALKGKGIPKFVVDKGNGESLVYQDIAKLKQDYKQDIPTPQTIKPALIKTLNELLQPIREEFQRSEGWQLADKSGYPPEVKPTKPTKAKKAKKEMKEKLNCRQGSPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.17
5 0.17
6 0.21
7 0.22
8 0.24
9 0.3
10 0.32
11 0.37
12 0.46
13 0.55
14 0.56
15 0.59
16 0.58
17 0.54
18 0.55
19 0.48
20 0.41
21 0.31
22 0.25
23 0.18
24 0.16
25 0.11
26 0.07
27 0.07
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.12
41 0.17
42 0.18
43 0.17
44 0.18
45 0.18
46 0.23
47 0.24
48 0.26
49 0.22
50 0.23
51 0.23
52 0.24
53 0.22
54 0.17
55 0.15
56 0.11
57 0.11
58 0.09
59 0.07
60 0.06
61 0.08
62 0.09
63 0.1
64 0.11
65 0.11
66 0.15
67 0.19
68 0.22
69 0.24
70 0.29
71 0.31
72 0.32
73 0.34
74 0.35
75 0.35
76 0.31
77 0.32
78 0.27
79 0.26
80 0.27
81 0.25
82 0.23
83 0.23
84 0.22
85 0.21
86 0.25
87 0.25
88 0.21
89 0.2
90 0.18
91 0.18
92 0.19
93 0.17
94 0.14
95 0.14
96 0.17
97 0.17
98 0.21
99 0.21
100 0.2
101 0.23
102 0.24
103 0.24
104 0.25
105 0.26
106 0.23
107 0.21
108 0.21
109 0.19
110 0.19
111 0.2
112 0.18
113 0.17
114 0.25
115 0.31
116 0.31
117 0.37
118 0.43
119 0.5
120 0.59
121 0.66
122 0.68
123 0.73
124 0.81
125 0.84
126 0.88
127 0.88
128 0.88
129 0.91
130 0.9
131 0.9
132 0.91
133 0.88
134 0.87
135 0.87
136 0.79