Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395RHW2

Protein Details
Accession A0A395RHW2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
305-324VSNWRVTKTFESRRLKKMKVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, vacu 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046536  DUF6601  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20246  DUF6601  
Amino Acid Sequences MASPTPPFTVRILERDFLAIASSSLKEDFGSLLPASARFNDDVVAPTSDPNFLERELSVSRLTDIQTWLWVCGRLMPPRQLHHQRLISRNIIISEQAELHMVWWRDRIFLKPLPKYLLDPNFWAANISHTAHLDVAAQSNLDSSARGFLYSYTALIAYKSDFRIAKEYGLLPEEITWEGWKAFAAQILENHQYDRVNPRYWYGELRLSRLNKIYAFHKGYLLRGYSRVASHTVYGDLIRDNFSVLAGILAYVVIALTAMQVGLGVDGLLEEPAFQNASYFLTVFALIVPLIGAVFIFLIVFVMIVSNWRVTKTFESRRLKKMKVSLLGRQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.32
4 0.24
5 0.22
6 0.15
7 0.11
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.11
14 0.11
15 0.12
16 0.11
17 0.13
18 0.12
19 0.13
20 0.14
21 0.15
22 0.16
23 0.15
24 0.17
25 0.15
26 0.15
27 0.14
28 0.14
29 0.15
30 0.17
31 0.18
32 0.15
33 0.16
34 0.17
35 0.18
36 0.17
37 0.16
38 0.15
39 0.13
40 0.15
41 0.13
42 0.17
43 0.16
44 0.18
45 0.17
46 0.16
47 0.17
48 0.17
49 0.18
50 0.16
51 0.17
52 0.15
53 0.19
54 0.19
55 0.19
56 0.18
57 0.18
58 0.15
59 0.2
60 0.24
61 0.26
62 0.31
63 0.37
64 0.4
65 0.43
66 0.53
67 0.56
68 0.57
69 0.59
70 0.61
71 0.61
72 0.62
73 0.64
74 0.57
75 0.48
76 0.45
77 0.37
78 0.3
79 0.24
80 0.18
81 0.14
82 0.12
83 0.1
84 0.1
85 0.09
86 0.09
87 0.12
88 0.13
89 0.12
90 0.15
91 0.15
92 0.17
93 0.19
94 0.21
95 0.22
96 0.27
97 0.35
98 0.35
99 0.38
100 0.39
101 0.39
102 0.38
103 0.4
104 0.41
105 0.34
106 0.32
107 0.31
108 0.28
109 0.27
110 0.25
111 0.17
112 0.13
113 0.14
114 0.14
115 0.13
116 0.12
117 0.13
118 0.12
119 0.12
120 0.1
121 0.08
122 0.08
123 0.07
124 0.07
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.04
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.1
137 0.1
138 0.09
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.06
145 0.08
146 0.08
147 0.11
148 0.12
149 0.13
150 0.17
151 0.17
152 0.17
153 0.16
154 0.16
155 0.14
156 0.14
157 0.13
158 0.09
159 0.09
160 0.09
161 0.08
162 0.08
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.08
172 0.08
173 0.1
174 0.14
175 0.16
176 0.16
177 0.16
178 0.15
179 0.14
180 0.15
181 0.21
182 0.22
183 0.22
184 0.22
185 0.24
186 0.26
187 0.27
188 0.29
189 0.25
190 0.28
191 0.26
192 0.29
193 0.33
194 0.31
195 0.32
196 0.32
197 0.31
198 0.25
199 0.26
200 0.25
201 0.28
202 0.3
203 0.28
204 0.3
205 0.29
206 0.3
207 0.31
208 0.3
209 0.23
210 0.21
211 0.21
212 0.19
213 0.18
214 0.18
215 0.17
216 0.16
217 0.16
218 0.15
219 0.14
220 0.13
221 0.12
222 0.12
223 0.11
224 0.11
225 0.11
226 0.1
227 0.1
228 0.1
229 0.09
230 0.09
231 0.07
232 0.07
233 0.04
234 0.04
235 0.04
236 0.03
237 0.03
238 0.03
239 0.02
240 0.02
241 0.02
242 0.02
243 0.02
244 0.02
245 0.02
246 0.02
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.02
253 0.03
254 0.03
255 0.03
256 0.03
257 0.04
258 0.04
259 0.05
260 0.06
261 0.06
262 0.06
263 0.07
264 0.09
265 0.1
266 0.09
267 0.09
268 0.09
269 0.1
270 0.09
271 0.09
272 0.07
273 0.06
274 0.06
275 0.05
276 0.04
277 0.04
278 0.04
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.04
290 0.04
291 0.06
292 0.07
293 0.1
294 0.11
295 0.13
296 0.14
297 0.18
298 0.27
299 0.35
300 0.44
301 0.51
302 0.61
303 0.67
304 0.76
305 0.82
306 0.78
307 0.77
308 0.76
309 0.75
310 0.74
311 0.73