Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395S2L2

Protein Details
Accession A0A395S2L2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-89HQEVVMRRQRRQRRRRTNQTLVHPVAHydrophilic
NLS Segment(s)
PositionSequence
73-77RRQRR
Subcellular Location(s) mito 12, nucl 6.5, cyto_nucl 6, cyto 4.5, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPTSANIGSWSRLSSIHARSKKCYSWDCLSPSEQAGIIVSVVATSMVLLFVYMYYLGRVTIAHQEVVMRRQRRQRRRRTNQTLVHPVALVQLPIAPQYPSQDIVYTYTPFIYQSADQVNNFQSQTTRILIPQHPIPAVAPLHPTTYAGYPVVHVQGQNDYHQTGHRSVSVLTSAPSERSSRRHTEWLRRLRRVFGLPLGRASTIASDSIPSTPIIPPSGRDGSRRGPRLGLPGPGRTRLGRSHYSGSERTLDAGYLGLGARHQDGERRETTGIQSPPSAVATVHSDDYDSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.32
4 0.4
5 0.46
6 0.49
7 0.54
8 0.61
9 0.62
10 0.63
11 0.61
12 0.58
13 0.58
14 0.61
15 0.6
16 0.56
17 0.53
18 0.48
19 0.42
20 0.37
21 0.29
22 0.22
23 0.18
24 0.14
25 0.11
26 0.08
27 0.07
28 0.05
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.07
48 0.14
49 0.16
50 0.15
51 0.15
52 0.18
53 0.2
54 0.27
55 0.33
56 0.29
57 0.34
58 0.43
59 0.54
60 0.62
61 0.71
62 0.76
63 0.8
64 0.88
65 0.93
66 0.94
67 0.94
68 0.91
69 0.89
70 0.87
71 0.77
72 0.67
73 0.55
74 0.45
75 0.37
76 0.29
77 0.19
78 0.1
79 0.09
80 0.08
81 0.09
82 0.09
83 0.07
84 0.07
85 0.1
86 0.12
87 0.13
88 0.13
89 0.13
90 0.13
91 0.16
92 0.17
93 0.15
94 0.14
95 0.12
96 0.12
97 0.11
98 0.11
99 0.1
100 0.08
101 0.1
102 0.14
103 0.15
104 0.15
105 0.17
106 0.18
107 0.19
108 0.18
109 0.16
110 0.12
111 0.12
112 0.15
113 0.15
114 0.14
115 0.12
116 0.17
117 0.18
118 0.2
119 0.2
120 0.2
121 0.18
122 0.18
123 0.17
124 0.15
125 0.14
126 0.13
127 0.12
128 0.11
129 0.12
130 0.12
131 0.12
132 0.1
133 0.1
134 0.11
135 0.09
136 0.08
137 0.08
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.11
144 0.12
145 0.13
146 0.13
147 0.12
148 0.12
149 0.14
150 0.16
151 0.14
152 0.14
153 0.13
154 0.13
155 0.13
156 0.14
157 0.13
158 0.11
159 0.1
160 0.11
161 0.1
162 0.1
163 0.12
164 0.13
165 0.15
166 0.2
167 0.25
168 0.29
169 0.33
170 0.41
171 0.46
172 0.55
173 0.62
174 0.68
175 0.71
176 0.72
177 0.7
178 0.64
179 0.63
180 0.55
181 0.48
182 0.45
183 0.42
184 0.35
185 0.35
186 0.33
187 0.28
188 0.25
189 0.23
190 0.17
191 0.11
192 0.11
193 0.09
194 0.08
195 0.09
196 0.09
197 0.1
198 0.09
199 0.1
200 0.1
201 0.12
202 0.14
203 0.13
204 0.14
205 0.19
206 0.26
207 0.25
208 0.27
209 0.3
210 0.36
211 0.45
212 0.49
213 0.44
214 0.41
215 0.41
216 0.47
217 0.45
218 0.44
219 0.38
220 0.42
221 0.43
222 0.44
223 0.44
224 0.37
225 0.38
226 0.37
227 0.4
228 0.37
229 0.39
230 0.42
231 0.44
232 0.49
233 0.47
234 0.44
235 0.41
236 0.36
237 0.32
238 0.27
239 0.22
240 0.17
241 0.15
242 0.11
243 0.09
244 0.08
245 0.06
246 0.06
247 0.08
248 0.09
249 0.11
250 0.11
251 0.16
252 0.2
253 0.26
254 0.27
255 0.3
256 0.3
257 0.3
258 0.33
259 0.36
260 0.35
261 0.31
262 0.31
263 0.28
264 0.28
265 0.28
266 0.24
267 0.15
268 0.15
269 0.18
270 0.19
271 0.2
272 0.18