Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RZ88

Protein Details
Accession A0A395RZ88    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-119EKMAEKMHKKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
22-40RKNGKQWHAPKKAFRPTAG
57-115VKAKEREMKEEKEEERQRKVQAIKEKRAKKEEKERYEKMAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDTENTNLTPAPAAEKNLGMRKNGKQWHAPKKAFRPTAGLRSYEKRSQERAQMMQVKAKEREMKEEKEEERQRKVQAIKEKRAKKEEKERYEKMAEKMHKKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.26
5 0.32
6 0.33
7 0.31
8 0.35
9 0.38
10 0.45
11 0.49
12 0.48
13 0.5
14 0.58
15 0.66
16 0.7
17 0.7
18 0.7
19 0.73
20 0.79
21 0.73
22 0.64
23 0.61
24 0.55
25 0.59
26 0.53
27 0.46
28 0.4
29 0.41
30 0.45
31 0.42
32 0.43
33 0.38
34 0.42
35 0.43
36 0.46
37 0.46
38 0.43
39 0.45
40 0.46
41 0.43
42 0.41
43 0.39
44 0.36
45 0.32
46 0.33
47 0.32
48 0.26
49 0.34
50 0.35
51 0.36
52 0.36
53 0.42
54 0.4
55 0.44
56 0.52
57 0.47
58 0.49
59 0.49
60 0.47
61 0.47
62 0.5
63 0.46
64 0.49
65 0.53
66 0.56
67 0.62
68 0.68
69 0.69
70 0.75
71 0.75
72 0.73
73 0.75
74 0.77
75 0.77
76 0.79
77 0.75
78 0.73
79 0.73
80 0.7
81 0.63
82 0.62
83 0.59
84 0.61
85 0.66
86 0.69
87 0.69
88 0.67
89 0.72
90 0.74
91 0.77
92 0.78
93 0.8
94 0.82
95 0.84
96 0.92
97 0.94
98 0.94
99 0.93