Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395SC36

Protein Details
Accession A0A395SC36    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ILACVLCQQRKKKCDRKSPCSFCTKAHydrophilic
39-61QCIPSTPAPKRSRRKPTKELLARHydrophilic
NLS Segment(s)
PositionSequence
48-54KRSRRKP
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MASEQQRPPRILACVLCQQRKKKCDRKSPCSFCTKAGVQCIPSTPAPKRSRRKPTKELLARLERCEELLKRCTCVQRSLMYNSFEHRDMSSPTYTSTEGSNGSASPEREKIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.5
4 0.53
5 0.59
6 0.63
7 0.69
8 0.74
9 0.75
10 0.77
11 0.81
12 0.84
13 0.86
14 0.88
15 0.88
16 0.84
17 0.83
18 0.74
19 0.65
20 0.61
21 0.55
22 0.47
23 0.43
24 0.39
25 0.32
26 0.31
27 0.3
28 0.26
29 0.24
30 0.24
31 0.21
32 0.29
33 0.35
34 0.43
35 0.51
36 0.58
37 0.68
38 0.74
39 0.81
40 0.79
41 0.81
42 0.82
43 0.8
44 0.75
45 0.71
46 0.7
47 0.63
48 0.56
49 0.5
50 0.39
51 0.33
52 0.31
53 0.26
54 0.21
55 0.27
56 0.26
57 0.26
58 0.3
59 0.35
60 0.33
61 0.36
62 0.35
63 0.32
64 0.35
65 0.39
66 0.4
67 0.37
68 0.36
69 0.34
70 0.33
71 0.29
72 0.26
73 0.21
74 0.19
75 0.2
76 0.23
77 0.22
78 0.2
79 0.21
80 0.22
81 0.22
82 0.2
83 0.18
84 0.16
85 0.16
86 0.16
87 0.16
88 0.13
89 0.16
90 0.2
91 0.21
92 0.23
93 0.26