Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RTS3

Protein Details
Accession A0A395RTS3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
58-81HEAAKKSKKTKTPTAPPPPPPPPAHydrophilic
NLS Segment(s)
PositionSequence
62-74KKSKKTKTPTAPP
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MPINGTGRNANRRLPSWLTSSPLPPSDAQKERRRPNDEILSDPASDILIDFNSSEGFHEAAKKSKKTKTPTAPPPPPPPPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.41
4 0.41
5 0.39
6 0.36
7 0.36
8 0.33
9 0.29
10 0.28
11 0.23
12 0.26
13 0.3
14 0.35
15 0.4
16 0.46
17 0.54
18 0.61
19 0.69
20 0.7
21 0.65
22 0.66
23 0.67
24 0.59
25 0.53
26 0.49
27 0.42
28 0.35
29 0.32
30 0.24
31 0.14
32 0.13
33 0.09
34 0.06
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.07
43 0.07
44 0.07
45 0.12
46 0.14
47 0.21
48 0.28
49 0.33
50 0.39
51 0.46
52 0.54
53 0.57
54 0.66
55 0.69
56 0.73
57 0.78
58 0.83
59 0.84
60 0.84
61 0.85
62 0.81