Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395S0A1

Protein Details
Accession A0A395S0A1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-109NVAPGPPEKPPKRPKRKSTTRRNKAKKPRRRABasic
NLS Segment(s)
PositionSequence
83-109PPEKPPKRPKRKSTTRRNKAKKPRRRA
Subcellular Location(s) mito 8, plas 6, cyto 5, nucl 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCLYFSSKPDMYIVIWFRKLLVSTLWAIAAIIGRIFGCEKALKKQLYTAGSRLGFSSWTNDNTKPATTTERILEWIYNVAPGPPEKPPKRPKRKSTTRRNKAKKPRRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.27
5 0.27
6 0.27
7 0.21
8 0.17
9 0.14
10 0.14
11 0.15
12 0.14
13 0.12
14 0.11
15 0.1
16 0.09
17 0.07
18 0.05
19 0.05
20 0.04
21 0.05
22 0.06
23 0.06
24 0.07
25 0.1
26 0.12
27 0.17
28 0.24
29 0.24
30 0.24
31 0.28
32 0.31
33 0.31
34 0.32
35 0.28
36 0.26
37 0.26
38 0.26
39 0.23
40 0.18
41 0.15
42 0.13
43 0.15
44 0.11
45 0.14
46 0.16
47 0.17
48 0.19
49 0.19
50 0.2
51 0.18
52 0.17
53 0.19
54 0.18
55 0.2
56 0.19
57 0.18
58 0.2
59 0.19
60 0.18
61 0.13
62 0.14
63 0.12
64 0.11
65 0.1
66 0.09
67 0.09
68 0.1
69 0.12
70 0.17
71 0.27
72 0.3
73 0.4
74 0.5
75 0.6
76 0.71
77 0.8
78 0.84
79 0.85
80 0.93
81 0.93
82 0.94
83 0.95
84 0.94
85 0.95
86 0.95
87 0.94
88 0.94
89 0.95