Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395SJ96

Protein Details
Accession A0A395SJ96   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-117RGDPVWKHRKDRHDNRNPDFDYBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 9.833, cyto_mito 9.833, nucl 5.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR002925  Dienelactn_hydro  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF01738  DLH  
Amino Acid Sequences MGQFSSTLEKPKSEKYLAKPSGACCLKGTIHAGESRGTWKTIADVKTYITKPPEGKANGNILLYFPDVWGMFPNGLLVMDAFADAGYLVLGLDYFRGDPVWKHRKDRHDNRNPDFDYEAWKRKHTAFADEAVPKWVSAVKKTYGTSTSKFACVGYCFGAPYVCNELKGDTVTVGAFAHPAFLKEHHFQDLKKPLFLSCSEIDHTFDVPSRRRALDILQSKKKVFHYQVFSGVEHGFALRGDQNDPYQRWVKEQSLAGIVSWFDYWLSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.62
4 0.61
5 0.64
6 0.6
7 0.54
8 0.58
9 0.53
10 0.46
11 0.36
12 0.36
13 0.31
14 0.31
15 0.33
16 0.25
17 0.25
18 0.26
19 0.26
20 0.23
21 0.23
22 0.24
23 0.22
24 0.2
25 0.18
26 0.15
27 0.19
28 0.24
29 0.25
30 0.24
31 0.23
32 0.25
33 0.33
34 0.33
35 0.33
36 0.29
37 0.33
38 0.32
39 0.34
40 0.4
41 0.36
42 0.38
43 0.39
44 0.42
45 0.39
46 0.38
47 0.34
48 0.26
49 0.24
50 0.21
51 0.17
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.09
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.05
85 0.07
86 0.17
87 0.27
88 0.3
89 0.38
90 0.45
91 0.55
92 0.65
93 0.74
94 0.76
95 0.76
96 0.82
97 0.79
98 0.82
99 0.73
100 0.64
101 0.55
102 0.43
103 0.4
104 0.36
105 0.39
106 0.31
107 0.31
108 0.31
109 0.31
110 0.38
111 0.32
112 0.32
113 0.26
114 0.27
115 0.3
116 0.29
117 0.27
118 0.22
119 0.21
120 0.15
121 0.14
122 0.14
123 0.11
124 0.12
125 0.15
126 0.15
127 0.18
128 0.19
129 0.2
130 0.22
131 0.24
132 0.24
133 0.25
134 0.24
135 0.22
136 0.22
137 0.2
138 0.17
139 0.15
140 0.15
141 0.13
142 0.11
143 0.11
144 0.11
145 0.11
146 0.09
147 0.11
148 0.16
149 0.14
150 0.15
151 0.15
152 0.16
153 0.16
154 0.16
155 0.14
156 0.07
157 0.08
158 0.07
159 0.07
160 0.07
161 0.06
162 0.06
163 0.05
164 0.07
165 0.06
166 0.07
167 0.08
168 0.1
169 0.15
170 0.18
171 0.2
172 0.23
173 0.25
174 0.25
175 0.33
176 0.41
177 0.38
178 0.37
179 0.35
180 0.31
181 0.32
182 0.32
183 0.29
184 0.2
185 0.22
186 0.22
187 0.23
188 0.24
189 0.22
190 0.22
191 0.17
192 0.18
193 0.21
194 0.23
195 0.27
196 0.29
197 0.29
198 0.29
199 0.3
200 0.31
201 0.35
202 0.41
203 0.46
204 0.51
205 0.54
206 0.54
207 0.58
208 0.58
209 0.57
210 0.54
211 0.53
212 0.52
213 0.51
214 0.58
215 0.56
216 0.51
217 0.45
218 0.39
219 0.3
220 0.23
221 0.19
222 0.12
223 0.09
224 0.11
225 0.11
226 0.12
227 0.14
228 0.16
229 0.22
230 0.29
231 0.31
232 0.34
233 0.38
234 0.38
235 0.42
236 0.46
237 0.43
238 0.42
239 0.43
240 0.41
241 0.38
242 0.37
243 0.32
244 0.27
245 0.23
246 0.18
247 0.16
248 0.12