Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395SRE8

Protein Details
Accession A0A395SRE8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
234-265EIDRDERRRSPSRSRSRSRSHSPRRSRSGSGSBasic
NLS Segment(s)
PositionSequence
146-153RKLRRRGR
240-262RRRSPSRSRSRSRSHSPRRSRSG
Subcellular Location(s) nucl 18.5, cyto_nucl 15, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MSRDKDTVHADARRFLDERGSNVSVAPNGLNPATIMEKAVRDRIVDSIYYKMQCFACNEADIVDRVVEDVKFIGGTYGTTQVPSPFLCLAFKLLELSPSNAVLLEYLKFGGEAFKYLRALACFYFRLTRQAKDVYEMLEPFLEDRRKLRRRGREGVKLSYMDEFVDELLTKERVCGTSLWKMPKREVLEDLEILEPRISPLGDLEDLLEEEDEAEKENGTREESGEISEGDVMEIDRDERRRSPSRSRSRSRSHSPRRSRSGSGSGNRCRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.38
4 0.34
5 0.36
6 0.37
7 0.36
8 0.32
9 0.32
10 0.33
11 0.24
12 0.23
13 0.2
14 0.13
15 0.14
16 0.13
17 0.13
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.17
25 0.19
26 0.23
27 0.22
28 0.21
29 0.21
30 0.23
31 0.23
32 0.21
33 0.2
34 0.2
35 0.24
36 0.24
37 0.23
38 0.24
39 0.23
40 0.24
41 0.25
42 0.26
43 0.24
44 0.23
45 0.23
46 0.2
47 0.2
48 0.18
49 0.16
50 0.12
51 0.09
52 0.08
53 0.1
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.06
63 0.07
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.13
70 0.12
71 0.13
72 0.11
73 0.11
74 0.11
75 0.11
76 0.13
77 0.12
78 0.12
79 0.11
80 0.1
81 0.13
82 0.14
83 0.15
84 0.14
85 0.13
86 0.13
87 0.11
88 0.11
89 0.08
90 0.08
91 0.06
92 0.06
93 0.06
94 0.06
95 0.05
96 0.06
97 0.07
98 0.06
99 0.08
100 0.09
101 0.11
102 0.11
103 0.12
104 0.13
105 0.11
106 0.13
107 0.12
108 0.13
109 0.12
110 0.12
111 0.15
112 0.14
113 0.21
114 0.22
115 0.22
116 0.23
117 0.26
118 0.26
119 0.26
120 0.26
121 0.2
122 0.19
123 0.18
124 0.15
125 0.11
126 0.1
127 0.08
128 0.12
129 0.12
130 0.11
131 0.15
132 0.25
133 0.31
134 0.39
135 0.47
136 0.53
137 0.6
138 0.69
139 0.74
140 0.74
141 0.73
142 0.69
143 0.64
144 0.54
145 0.47
146 0.38
147 0.3
148 0.19
149 0.15
150 0.1
151 0.07
152 0.07
153 0.06
154 0.06
155 0.07
156 0.08
157 0.07
158 0.08
159 0.09
160 0.1
161 0.11
162 0.12
163 0.14
164 0.21
165 0.26
166 0.35
167 0.38
168 0.4
169 0.41
170 0.47
171 0.46
172 0.41
173 0.4
174 0.36
175 0.34
176 0.32
177 0.32
178 0.26
179 0.22
180 0.2
181 0.17
182 0.12
183 0.09
184 0.1
185 0.08
186 0.06
187 0.07
188 0.1
189 0.1
190 0.1
191 0.1
192 0.09
193 0.1
194 0.1
195 0.09
196 0.06
197 0.06
198 0.07
199 0.06
200 0.08
201 0.08
202 0.08
203 0.08
204 0.11
205 0.12
206 0.14
207 0.14
208 0.13
209 0.15
210 0.16
211 0.17
212 0.15
213 0.14
214 0.12
215 0.12
216 0.11
217 0.09
218 0.08
219 0.07
220 0.06
221 0.07
222 0.08
223 0.12
224 0.15
225 0.19
226 0.23
227 0.31
228 0.39
229 0.46
230 0.56
231 0.62
232 0.7
233 0.77
234 0.83
235 0.85
236 0.86
237 0.89
238 0.88
239 0.89
240 0.89
241 0.89
242 0.91
243 0.91
244 0.9
245 0.87
246 0.83
247 0.79
248 0.77
249 0.76
250 0.74
251 0.74
252 0.73