Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395SES2

Protein Details
Accession A0A395SES2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
156-176RSVWVGDKKMRNKYQKLFKSYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
IPR009799  EthD_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07110  EthD  
Amino Acid Sequences MVQIASFLTLAVGLVRTTLASPSNTGLLQMLTYVKRHPNMTRAEFWEYWDTQHAPKVIPLATNFGISRYQQIRVGGKIVPTDAGASAPASNKLVEFDGIAMFLYESPDDLTAMLAHPYYIDVVEPDEHVFIDKSAYGNGMVATYIGENIEVVDDERSVWVGDKKMRNKYQKLFKSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.08
6 0.1
7 0.1
8 0.12
9 0.13
10 0.16
11 0.15
12 0.15
13 0.14
14 0.12
15 0.11
16 0.1
17 0.12
18 0.11
19 0.13
20 0.16
21 0.21
22 0.24
23 0.28
24 0.3
25 0.34
26 0.41
27 0.45
28 0.46
29 0.46
30 0.49
31 0.45
32 0.45
33 0.44
34 0.36
35 0.32
36 0.3
37 0.27
38 0.22
39 0.26
40 0.23
41 0.19
42 0.19
43 0.21
44 0.17
45 0.18
46 0.17
47 0.18
48 0.18
49 0.19
50 0.18
51 0.16
52 0.17
53 0.15
54 0.2
55 0.17
56 0.18
57 0.19
58 0.22
59 0.23
60 0.22
61 0.23
62 0.18
63 0.18
64 0.16
65 0.14
66 0.12
67 0.1
68 0.09
69 0.07
70 0.06
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.06
110 0.07
111 0.07
112 0.08
113 0.08
114 0.07
115 0.09
116 0.09
117 0.07
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.04
135 0.05
136 0.05
137 0.05
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.08
144 0.08
145 0.1
146 0.13
147 0.18
148 0.26
149 0.35
150 0.43
151 0.53
152 0.62
153 0.69
154 0.75
155 0.79
156 0.82