Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395STD1

Protein Details
Accession A0A395STD1   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-80KDVKRLLPSTKEKKKHKKQKEVDEFCRNTDBasic
NLS Segment(s)
PositionSequence
58-69PSTKEKKKHKKQ
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MNTQLHQAHRERSVYYFDGPDELKMVIRKNVEYCVRNCFMDQVQKAKDVFKDVKRLLPSTKEKKKHKKQKEVDEFCRNTDDHNHLYDDAGNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.28
4 0.23
5 0.24
6 0.23
7 0.21
8 0.17
9 0.14
10 0.14
11 0.15
12 0.17
13 0.18
14 0.19
15 0.21
16 0.21
17 0.26
18 0.3
19 0.31
20 0.3
21 0.33
22 0.33
23 0.32
24 0.3
25 0.26
26 0.22
27 0.26
28 0.26
29 0.25
30 0.25
31 0.27
32 0.27
33 0.27
34 0.25
35 0.23
36 0.27
37 0.25
38 0.33
39 0.31
40 0.36
41 0.36
42 0.38
43 0.35
44 0.38
45 0.44
46 0.46
47 0.55
48 0.59
49 0.67
50 0.77
51 0.85
52 0.88
53 0.9
54 0.9
55 0.91
56 0.93
57 0.94
58 0.92
59 0.9
60 0.9
61 0.81
62 0.72
63 0.66
64 0.54
65 0.45
66 0.42
67 0.4
68 0.32
69 0.33
70 0.34
71 0.3
72 0.31