Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T809

Protein Details
Accession A0A397T809    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-30TLETTTKNMKRRSYRVKNFLEELHydrophilic
NLS Segment(s)
PositionSequence
85-95KNKKVNKDKVK
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLKNEESTLETTTKNMKRRSYRVKNFLEELPTLEMINKRTNNKEDNICIRCKVKNENWNHVWECEHNSTTLYEIEIYRKQKEIIKNKKVNKDKVKGSRTKSTNQIVSDEKLYELAKNNLVRNNKKLMSRVIADRYIEILITKQEKVQKIWSTTYIYDLEYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.5
4 0.57
5 0.67
6 0.76
7 0.78
8 0.82
9 0.84
10 0.85
11 0.81
12 0.75
13 0.69
14 0.62
15 0.51
16 0.43
17 0.36
18 0.29
19 0.23
20 0.22
21 0.21
22 0.2
23 0.27
24 0.29
25 0.3
26 0.36
27 0.41
28 0.42
29 0.45
30 0.48
31 0.46
32 0.51
33 0.5
34 0.46
35 0.44
36 0.43
37 0.4
38 0.39
39 0.41
40 0.4
41 0.44
42 0.49
43 0.55
44 0.55
45 0.58
46 0.55
47 0.48
48 0.41
49 0.35
50 0.33
51 0.27
52 0.25
53 0.19
54 0.18
55 0.17
56 0.17
57 0.16
58 0.11
59 0.08
60 0.08
61 0.11
62 0.15
63 0.18
64 0.18
65 0.18
66 0.2
67 0.23
68 0.32
69 0.39
70 0.45
71 0.53
72 0.6
73 0.66
74 0.74
75 0.78
76 0.79
77 0.78
78 0.74
79 0.73
80 0.74
81 0.76
82 0.74
83 0.71
84 0.71
85 0.65
86 0.62
87 0.61
88 0.57
89 0.53
90 0.47
91 0.45
92 0.38
93 0.36
94 0.34
95 0.26
96 0.21
97 0.18
98 0.17
99 0.16
100 0.17
101 0.18
102 0.21
103 0.25
104 0.28
105 0.31
106 0.39
107 0.42
108 0.43
109 0.48
110 0.47
111 0.46
112 0.47
113 0.47
114 0.44
115 0.43
116 0.44
117 0.42
118 0.41
119 0.39
120 0.35
121 0.32
122 0.27
123 0.23
124 0.17
125 0.13
126 0.15
127 0.17
128 0.17
129 0.2
130 0.26
131 0.29
132 0.33
133 0.4
134 0.43
135 0.44
136 0.48
137 0.48
138 0.47
139 0.44
140 0.45
141 0.37