Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T2H2

Protein Details
Accession A0A397T2H2    Localization Confidence High Confidence Score 22.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-52YEESKPNKKKVGKKALKLEYQSHydrophilic
65-85EESKPNKKKIGKKALKPEGKSBasic
95-117VSNYEYKTKKSNKQPKWLKSSKKHydrophilic
NLS Segment(s)
PositionSequence
7-7K
37-44NKKKVGKK
68-93KPNKKKIGKKALKPEGKSRESKNSYK
101-117KTKKSNKQPKWLKSSKK
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences SKSNKKKVGKKALKLEYQSDESIISESDSSYEESKPNKKKVGKKALKLEYQSEESNNSEYYLPYEESKPNKKKIGKKALKPEGKSRESKNSYKHVSNYEYKTKKSNKQPKWLKSSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.73
3 0.67
4 0.61
5 0.52
6 0.42
7 0.33
8 0.26
9 0.23
10 0.17
11 0.12
12 0.08
13 0.08
14 0.08
15 0.08
16 0.09
17 0.1
18 0.12
19 0.14
20 0.2
21 0.29
22 0.36
23 0.41
24 0.48
25 0.54
26 0.62
27 0.7
28 0.76
29 0.75
30 0.76
31 0.81
32 0.82
33 0.82
34 0.75
35 0.68
36 0.6
37 0.54
38 0.46
39 0.36
40 0.29
41 0.22
42 0.2
43 0.17
44 0.14
45 0.11
46 0.1
47 0.11
48 0.11
49 0.11
50 0.11
51 0.13
52 0.16
53 0.22
54 0.32
55 0.37
56 0.41
57 0.48
58 0.55
59 0.61
60 0.68
61 0.73
62 0.72
63 0.74
64 0.8
65 0.82
66 0.82
67 0.77
68 0.76
69 0.74
70 0.71
71 0.68
72 0.62
73 0.63
74 0.62
75 0.64
76 0.62
77 0.61
78 0.62
79 0.62
80 0.61
81 0.56
82 0.56
83 0.58
84 0.58
85 0.59
86 0.58
87 0.55
88 0.6
89 0.62
90 0.65
91 0.69
92 0.73
93 0.72
94 0.78
95 0.86
96 0.87
97 0.89