Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SUY6

Protein Details
Accession A0A397SUY6   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKHSRRYREIKEQIRHRPPSTBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
Amino Acid Sequences MKHSRRYREIKEQIRHRPPSTAEESLEFLRQNNREKIKNIKVSLALKQNKQEKKTVLRQKIILPXPLPVKEKLAVVKDNLSPDTIKSLAQNKSVXLLSAEEVHQRVIVEETGKVRKKSQVVVRRTILSENTLVEVEKFQHGEVELKTDLGGNIQAVVGKSDFSLEQLEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.77
4 0.73
5 0.66
6 0.64
7 0.61
8 0.54
9 0.45
10 0.4
11 0.4
12 0.35
13 0.34
14 0.27
15 0.21
16 0.25
17 0.28
18 0.33
19 0.39
20 0.43
21 0.46
22 0.49
23 0.58
24 0.6
25 0.64
26 0.58
27 0.53
28 0.53
29 0.52
30 0.54
31 0.54
32 0.49
33 0.44
34 0.5
35 0.55
36 0.55
37 0.55
38 0.55
39 0.51
40 0.54
41 0.61
42 0.64
43 0.63
44 0.61
45 0.6
46 0.61
47 0.62
48 0.57
49 0.5
50 0.43
51 0.38
52 0.37
53 0.38
54 0.33
55 0.27
56 0.24
57 0.23
58 0.24
59 0.24
60 0.22
61 0.19
62 0.22
63 0.22
64 0.22
65 0.2
66 0.18
67 0.14
68 0.13
69 0.15
70 0.12
71 0.11
72 0.11
73 0.17
74 0.19
75 0.21
76 0.21
77 0.19
78 0.19
79 0.19
80 0.17
81 0.11
82 0.1
83 0.08
84 0.11
85 0.12
86 0.11
87 0.11
88 0.11
89 0.1
90 0.1
91 0.11
92 0.08
93 0.08
94 0.09
95 0.13
96 0.2
97 0.25
98 0.25
99 0.27
100 0.31
101 0.34
102 0.4
103 0.46
104 0.47
105 0.49
106 0.55
107 0.56
108 0.53
109 0.51
110 0.46
111 0.38
112 0.31
113 0.26
114 0.2
115 0.18
116 0.15
117 0.14
118 0.13
119 0.12
120 0.12
121 0.13
122 0.13
123 0.11
124 0.13
125 0.14
126 0.17
127 0.16
128 0.19
129 0.17
130 0.16
131 0.16
132 0.16
133 0.15
134 0.12
135 0.13
136 0.08
137 0.08
138 0.08
139 0.1
140 0.09
141 0.11
142 0.1
143 0.1
144 0.09
145 0.11
146 0.11
147 0.11
148 0.16