Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SVG4

Protein Details
Accession A0A397SVG4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
38-59TLYRGKYTTGRRHKPIKQIECVHydrophilic
250-273NNNINNYSRIRRRRREASPSYSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, E.R. 4, golg 4, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009567  SARAF  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006816  P:calcium ion transport  
GO:2001256  P:regulation of store-operated calcium entry  
Pfam View protein in Pfam  
PF06682  SARAF  
Amino Acid Sequences MKIQIISSVILISFCILTFVQVEGWDDKVLLEKVRALTLYRGKYTTGRRHKPIKQIECVGGDAGCRYEPDVIQCRNIGSDGINPNWKCEADLPKSLKFGRLKVTCEGYEHPNDQNVLKGSCGLKYTLFLTNDHTSDRKRKQWFNNWFDDEKRNDNFKVDDETESLFGTLFTIAWIGMVGYILYNMYLTYMRTRREDNRSSDYGDGDVPHHNPDFSSSTSRAYRRENIPNPGFWTGVLGGGLFGYLFARRNNNINNYSRIRRRRREASPSYSTSSSYFTRNDYDWNNDHSDYSSHTTTTSYDDDTYTAYGFAETDNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.08
4 0.08
5 0.09
6 0.1
7 0.1
8 0.11
9 0.14
10 0.13
11 0.15
12 0.14
13 0.13
14 0.13
15 0.17
16 0.18
17 0.16
18 0.16
19 0.18
20 0.2
21 0.22
22 0.23
23 0.19
24 0.25
25 0.32
26 0.36
27 0.35
28 0.34
29 0.34
30 0.4
31 0.48
32 0.52
33 0.55
34 0.58
35 0.63
36 0.72
37 0.78
38 0.81
39 0.83
40 0.8
41 0.77
42 0.74
43 0.7
44 0.62
45 0.56
46 0.46
47 0.35
48 0.27
49 0.2
50 0.15
51 0.11
52 0.09
53 0.09
54 0.11
55 0.11
56 0.17
57 0.25
58 0.25
59 0.27
60 0.28
61 0.27
62 0.26
63 0.25
64 0.19
65 0.12
66 0.17
67 0.19
68 0.21
69 0.28
70 0.27
71 0.29
72 0.3
73 0.29
74 0.24
75 0.26
76 0.31
77 0.29
78 0.37
79 0.39
80 0.4
81 0.44
82 0.43
83 0.45
84 0.39
85 0.37
86 0.39
87 0.39
88 0.39
89 0.39
90 0.43
91 0.36
92 0.36
93 0.36
94 0.31
95 0.31
96 0.3
97 0.27
98 0.25
99 0.25
100 0.22
101 0.23
102 0.2
103 0.17
104 0.14
105 0.16
106 0.15
107 0.15
108 0.16
109 0.14
110 0.12
111 0.12
112 0.15
113 0.17
114 0.18
115 0.16
116 0.21
117 0.22
118 0.23
119 0.23
120 0.23
121 0.21
122 0.29
123 0.34
124 0.37
125 0.42
126 0.49
127 0.57
128 0.66
129 0.73
130 0.7
131 0.73
132 0.69
133 0.64
134 0.58
135 0.54
136 0.46
137 0.41
138 0.38
139 0.33
140 0.29
141 0.28
142 0.26
143 0.23
144 0.25
145 0.21
146 0.19
147 0.17
148 0.17
149 0.16
150 0.15
151 0.14
152 0.09
153 0.07
154 0.06
155 0.05
156 0.04
157 0.03
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.02
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.04
174 0.05
175 0.11
176 0.15
177 0.17
178 0.19
179 0.24
180 0.3
181 0.38
182 0.44
183 0.44
184 0.48
185 0.48
186 0.48
187 0.45
188 0.39
189 0.31
190 0.25
191 0.2
192 0.15
193 0.15
194 0.13
195 0.15
196 0.14
197 0.13
198 0.13
199 0.15
200 0.17
201 0.17
202 0.21
203 0.19
204 0.24
205 0.29
206 0.32
207 0.32
208 0.35
209 0.39
210 0.42
211 0.51
212 0.53
213 0.57
214 0.57
215 0.55
216 0.54
217 0.49
218 0.42
219 0.31
220 0.28
221 0.19
222 0.16
223 0.14
224 0.1
225 0.08
226 0.07
227 0.07
228 0.04
229 0.04
230 0.04
231 0.05
232 0.07
233 0.09
234 0.14
235 0.16
236 0.23
237 0.29
238 0.36
239 0.41
240 0.43
241 0.49
242 0.51
243 0.57
244 0.61
245 0.65
246 0.68
247 0.71
248 0.76
249 0.79
250 0.82
251 0.85
252 0.84
253 0.83
254 0.81
255 0.76
256 0.72
257 0.63
258 0.55
259 0.45
260 0.4
261 0.33
262 0.29
263 0.26
264 0.23
265 0.26
266 0.26
267 0.3
268 0.3
269 0.36
270 0.35
271 0.39
272 0.41
273 0.37
274 0.37
275 0.33
276 0.3
277 0.28
278 0.3
279 0.26
280 0.22
281 0.22
282 0.22
283 0.21
284 0.25
285 0.22
286 0.19
287 0.19
288 0.2
289 0.2
290 0.21
291 0.21
292 0.16
293 0.14
294 0.11
295 0.1
296 0.1