Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TD76

Protein Details
Accession A0A397TD76    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
144-171GSKDTSKKSKNSSKDSNKKNKPKSQTSSHydrophilic
NLS Segment(s)
PositionSequence
149-166SKKSKNSSKDSNKKNKPK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, cyto 3.5, mito 3, pero 2
Family & Domain DBs
Amino Acid Sequences MLYDIPGNWDAEKITEEINKNLGFLIKASVTAKGKYRCNIPIRWFSGDWFLVQQQQQLAQQAVIKNLPSTCNELDIFKEFKETFNWEAIKLVKTSKGSKLISYFGHHDDLIKVLRQPFIISYKSYNWSHDTFSCTKSPDKKSYGSKDTSKKSKNSSKDSNKKNKPKSQTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.21
4 0.22
5 0.27
6 0.26
7 0.24
8 0.24
9 0.22
10 0.17
11 0.15
12 0.16
13 0.11
14 0.13
15 0.14
16 0.19
17 0.2
18 0.22
19 0.29
20 0.32
21 0.37
22 0.38
23 0.43
24 0.46
25 0.49
26 0.53
27 0.52
28 0.55
29 0.55
30 0.57
31 0.52
32 0.44
33 0.44
34 0.38
35 0.32
36 0.24
37 0.21
38 0.2
39 0.2
40 0.2
41 0.15
42 0.17
43 0.17
44 0.17
45 0.17
46 0.14
47 0.16
48 0.15
49 0.16
50 0.15
51 0.14
52 0.13
53 0.13
54 0.14
55 0.13
56 0.17
57 0.15
58 0.17
59 0.17
60 0.17
61 0.17
62 0.19
63 0.19
64 0.14
65 0.17
66 0.14
67 0.15
68 0.17
69 0.19
70 0.17
71 0.2
72 0.21
73 0.17
74 0.19
75 0.19
76 0.18
77 0.15
78 0.15
79 0.14
80 0.16
81 0.19
82 0.21
83 0.27
84 0.27
85 0.28
86 0.3
87 0.29
88 0.28
89 0.28
90 0.27
91 0.21
92 0.23
93 0.2
94 0.19
95 0.16
96 0.17
97 0.15
98 0.13
99 0.13
100 0.13
101 0.15
102 0.15
103 0.15
104 0.15
105 0.18
106 0.19
107 0.19
108 0.2
109 0.23
110 0.28
111 0.29
112 0.29
113 0.29
114 0.29
115 0.31
116 0.3
117 0.33
118 0.3
119 0.32
120 0.32
121 0.31
122 0.35
123 0.41
124 0.46
125 0.48
126 0.5
127 0.54
128 0.6
129 0.67
130 0.68
131 0.66
132 0.67
133 0.68
134 0.73
135 0.76
136 0.73
137 0.71
138 0.73
139 0.76
140 0.77
141 0.77
142 0.79
143 0.8
144 0.83
145 0.87
146 0.89
147 0.9
148 0.92
149 0.93
150 0.91
151 0.9