Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SQ73

Protein Details
Accession A0A397SQ73   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-128NVIKNFWNQRRRKIYREKNIEYVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
Amino Acid Sequences MGRMKQTLFTKEIDNVIIELMKKWGHLPKPYVKIHEAIPQYTSKQIRQRWISILDPRLCRKSLDEDEKSFIIQWVEKNRQPNGTIHWKDLINEIEQISGKLRSENVIKNFWNQRRRKIYREKNIEYVIQSTHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.18
4 0.17
5 0.14
6 0.12
7 0.13
8 0.12
9 0.11
10 0.15
11 0.21
12 0.25
13 0.31
14 0.37
15 0.43
16 0.52
17 0.55
18 0.56
19 0.51
20 0.47
21 0.44
22 0.44
23 0.37
24 0.3
25 0.28
26 0.25
27 0.25
28 0.29
29 0.29
30 0.27
31 0.33
32 0.37
33 0.43
34 0.45
35 0.47
36 0.45
37 0.46
38 0.44
39 0.42
40 0.45
41 0.42
42 0.41
43 0.41
44 0.4
45 0.37
46 0.33
47 0.3
48 0.31
49 0.33
50 0.37
51 0.38
52 0.36
53 0.38
54 0.38
55 0.36
56 0.28
57 0.21
58 0.13
59 0.11
60 0.13
61 0.18
62 0.23
63 0.25
64 0.3
65 0.31
66 0.33
67 0.33
68 0.32
69 0.31
70 0.36
71 0.36
72 0.33
73 0.35
74 0.32
75 0.31
76 0.33
77 0.29
78 0.19
79 0.19
80 0.18
81 0.16
82 0.16
83 0.16
84 0.14
85 0.14
86 0.13
87 0.12
88 0.13
89 0.14
90 0.19
91 0.26
92 0.28
93 0.33
94 0.34
95 0.4
96 0.49
97 0.55
98 0.59
99 0.58
100 0.64
101 0.69
102 0.75
103 0.77
104 0.79
105 0.82
106 0.83
107 0.88
108 0.84
109 0.8
110 0.77
111 0.71
112 0.62
113 0.54