Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S4Q7

Protein Details
Accession A0A397S4Q7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-98LSFINRNKLSKKNKKEKNKEILTINHydrophilic
NLS Segment(s)
PositionSequence
81-90KLSKKNKKEK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MLKQEKLFNEKCYKTIEIYNKSKVPYTHHDKSEIKKIQELITRKASYNQKNKKFVINLTSNELYTKPSSKRNLLSFINRNKLSKKNKKEKNKEILTINEISELEIEEKKMALREHAAEVRKKEVEAEVLEIVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.48
4 0.47
5 0.52
6 0.57
7 0.55
8 0.54
9 0.55
10 0.48
11 0.46
12 0.46
13 0.49
14 0.5
15 0.49
16 0.55
17 0.56
18 0.59
19 0.62
20 0.6
21 0.52
22 0.48
23 0.47
24 0.45
25 0.47
26 0.46
27 0.41
28 0.42
29 0.42
30 0.39
31 0.44
32 0.48
33 0.5
34 0.57
35 0.62
36 0.62
37 0.67
38 0.68
39 0.67
40 0.61
41 0.55
42 0.51
43 0.47
44 0.39
45 0.38
46 0.37
47 0.31
48 0.28
49 0.26
50 0.2
51 0.16
52 0.19
53 0.16
54 0.22
55 0.25
56 0.29
57 0.33
58 0.34
59 0.38
60 0.37
61 0.42
62 0.44
63 0.47
64 0.51
65 0.47
66 0.47
67 0.45
68 0.51
69 0.55
70 0.57
71 0.61
72 0.64
73 0.72
74 0.82
75 0.88
76 0.9
77 0.89
78 0.85
79 0.8
80 0.74
81 0.69
82 0.62
83 0.53
84 0.43
85 0.34
86 0.27
87 0.22
88 0.18
89 0.14
90 0.12
91 0.11
92 0.11
93 0.1
94 0.1
95 0.11
96 0.14
97 0.14
98 0.14
99 0.17
100 0.19
101 0.25
102 0.31
103 0.36
104 0.38
105 0.4
106 0.44
107 0.41
108 0.39
109 0.35
110 0.31
111 0.31
112 0.27
113 0.28
114 0.24