Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S0I5

Protein Details
Accession A0A397S0I5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-68LYYIGKKRRFYRRVNMNDDRLHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 10, plas 5, golg 5, mito 3, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDVPRLYGLCGRSKMLSFCFASFVLSPHCLLNLLLLIPNTDVIDAIVLYYIGKKRRFYRRVNMNDDRLHIISSIEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.31
4 0.26
5 0.24
6 0.24
7 0.22
8 0.22
9 0.19
10 0.18
11 0.16
12 0.15
13 0.15
14 0.13
15 0.13
16 0.11
17 0.11
18 0.1
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.06
37 0.1
38 0.16
39 0.2
40 0.25
41 0.33
42 0.44
43 0.52
44 0.58
45 0.65
46 0.7
47 0.76
48 0.81
49 0.81
50 0.77
51 0.73
52 0.68
53 0.63
54 0.53
55 0.44
56 0.35