Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SIW3

Protein Details
Accession A0A397SIW3   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-115LPPASISKVKQPNKKKNKELQCCRKKLTIKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTTCLEAAIEDIHSKEMLISEFTANLKNPYMKISSGLISTNNTNDSSIITLITIPDDQSIQPHKDQLQDLMHLDIPDDEMPKSATLPPASISKVKQPNKKKNKELQCCRKKLTIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.1
6 0.11
7 0.11
8 0.13
9 0.14
10 0.16
11 0.15
12 0.16
13 0.17
14 0.18
15 0.18
16 0.19
17 0.2
18 0.18
19 0.19
20 0.19
21 0.18
22 0.17
23 0.17
24 0.15
25 0.14
26 0.15
27 0.14
28 0.14
29 0.13
30 0.12
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.08
46 0.11
47 0.13
48 0.13
49 0.15
50 0.16
51 0.19
52 0.2
53 0.21
54 0.2
55 0.2
56 0.2
57 0.19
58 0.19
59 0.15
60 0.15
61 0.11
62 0.11
63 0.1
64 0.1
65 0.09
66 0.08
67 0.09
68 0.09
69 0.11
70 0.11
71 0.14
72 0.14
73 0.14
74 0.15
75 0.18
76 0.2
77 0.22
78 0.22
79 0.28
80 0.38
81 0.45
82 0.53
83 0.61
84 0.69
85 0.77
86 0.86
87 0.87
88 0.87
89 0.9
90 0.92
91 0.93
92 0.93
93 0.92
94 0.9
95 0.85