Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SGK0

Protein Details
Accession A0A397SGK0    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31SDEIQRRVPKWKKLLSLKNSSSHydrophilic
53-95IDHHSFKIIEKKRKKDKSEVELSKEEGKNKKDIHKKKIQKVNYBasic
NLS Segment(s)
PositionSequence
62-90EKKRKKDKSEVELSKEEGKNKKDIHKKKI
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences MSTFEQDKASDEIQRRVPKWKKLLSLKNSSSAILEYSSEENKSIKELRDESHIDHHSFKIIEKKRKKDKSEVELSKEEGKNKKDIHKKKIQKVNYDKINDEKDSDCNESENLSEQLPLENKMTDDLNSVLVVEQMKLKIPEEFTHAVKAGLNYLIIWRYHREKWKFQKTRQIWLLKNAYNEELLSEDFFNIFLEYIAELLGHSRNRTFKIARDVVNRFESEQKGDETTDQKDNEKGKEQIKLNRAKAIVRVLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.54
4 0.61
5 0.64
6 0.69
7 0.71
8 0.72
9 0.74
10 0.82
11 0.8
12 0.82
13 0.76
14 0.74
15 0.67
16 0.57
17 0.48
18 0.38
19 0.31
20 0.21
21 0.18
22 0.14
23 0.16
24 0.17
25 0.17
26 0.17
27 0.17
28 0.16
29 0.2
30 0.22
31 0.22
32 0.26
33 0.29
34 0.29
35 0.36
36 0.38
37 0.36
38 0.4
39 0.41
40 0.36
41 0.36
42 0.35
43 0.31
44 0.29
45 0.28
46 0.29
47 0.35
48 0.43
49 0.5
50 0.6
51 0.68
52 0.77
53 0.81
54 0.81
55 0.82
56 0.81
57 0.83
58 0.79
59 0.74
60 0.67
61 0.64
62 0.62
63 0.54
64 0.51
65 0.46
66 0.42
67 0.43
68 0.44
69 0.51
70 0.53
71 0.59
72 0.62
73 0.67
74 0.74
75 0.76
76 0.82
77 0.79
78 0.79
79 0.8
80 0.8
81 0.77
82 0.71
83 0.63
84 0.58
85 0.56
86 0.46
87 0.39
88 0.31
89 0.26
90 0.27
91 0.27
92 0.22
93 0.18
94 0.18
95 0.16
96 0.15
97 0.15
98 0.12
99 0.1
100 0.1
101 0.09
102 0.11
103 0.11
104 0.12
105 0.11
106 0.1
107 0.1
108 0.1
109 0.11
110 0.09
111 0.09
112 0.08
113 0.08
114 0.08
115 0.08
116 0.06
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.08
123 0.08
124 0.09
125 0.09
126 0.11
127 0.11
128 0.16
129 0.18
130 0.18
131 0.19
132 0.19
133 0.17
134 0.17
135 0.16
136 0.12
137 0.1
138 0.09
139 0.07
140 0.08
141 0.09
142 0.09
143 0.1
144 0.12
145 0.16
146 0.22
147 0.31
148 0.36
149 0.44
150 0.55
151 0.65
152 0.71
153 0.72
154 0.77
155 0.72
156 0.76
157 0.74
158 0.72
159 0.63
160 0.62
161 0.64
162 0.56
163 0.55
164 0.46
165 0.39
166 0.31
167 0.29
168 0.21
169 0.15
170 0.13
171 0.11
172 0.1
173 0.09
174 0.08
175 0.08
176 0.08
177 0.07
178 0.07
179 0.05
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.06
187 0.1
188 0.11
189 0.12
190 0.16
191 0.2
192 0.23
193 0.3
194 0.31
195 0.33
196 0.42
197 0.47
198 0.49
199 0.53
200 0.54
201 0.53
202 0.55
203 0.5
204 0.42
205 0.42
206 0.39
207 0.34
208 0.33
209 0.3
210 0.27
211 0.27
212 0.3
213 0.27
214 0.29
215 0.32
216 0.32
217 0.32
218 0.36
219 0.4
220 0.41
221 0.44
222 0.46
223 0.44
224 0.5
225 0.55
226 0.57
227 0.61
228 0.66
229 0.62
230 0.63
231 0.6
232 0.55
233 0.53