Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TPM0

Protein Details
Accession A0A397TPM0   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-102ISENKEHDRKRRKLDHLIDSABasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9, cyto_nucl 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027074  Integrator_9su  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Gene Ontology GO:0032039  C:integrator complex  
GO:0016180  P:snRNA processing  
Amino Acid Sequences MKLXNNLPLSRNLRRNCFLIKLMQMNFLIDCGLDTFYFLEFPPRDIIGLKPQQHISVVVEVSSNISDHSDHTSXLNDATPSNVISENKEHDRKRRKLDHLIDSAXDGSGGAGGGGRRRGQFLVETPEFSSIDWNSIDFIFITNYNNMLALPYVTEYTDFKGKIYATEPTVLFGRRTHSQPGFTNIFTGVNTDRKVARSLYSIADIQSCTDKVRPVRFGEHLNLYELEVTAYMYSSSTVQNTHPLPFDETVSNNADVIILSDLRDKDGQKMYLLDNPMPHQDMIEQLSLYYATRADRSLQEKYQEPCVVFAGHPSLRSGAAINFIRKWGNNSNNSIIFTGLYINNYLYYNLNNFITN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.56
4 0.51
5 0.48
6 0.49
7 0.48
8 0.46
9 0.47
10 0.42
11 0.38
12 0.35
13 0.28
14 0.22
15 0.13
16 0.12
17 0.08
18 0.09
19 0.08
20 0.08
21 0.09
22 0.09
23 0.1
24 0.1
25 0.17
26 0.16
27 0.19
28 0.21
29 0.2
30 0.21
31 0.21
32 0.24
33 0.26
34 0.34
35 0.36
36 0.38
37 0.38
38 0.39
39 0.39
40 0.38
41 0.3
42 0.27
43 0.22
44 0.18
45 0.17
46 0.16
47 0.16
48 0.14
49 0.12
50 0.07
51 0.08
52 0.08
53 0.09
54 0.15
55 0.15
56 0.14
57 0.15
58 0.21
59 0.2
60 0.2
61 0.21
62 0.15
63 0.16
64 0.16
65 0.16
66 0.12
67 0.14
68 0.15
69 0.15
70 0.19
71 0.24
72 0.3
73 0.38
74 0.4
75 0.48
76 0.58
77 0.63
78 0.69
79 0.74
80 0.74
81 0.77
82 0.82
83 0.81
84 0.76
85 0.71
86 0.61
87 0.51
88 0.43
89 0.32
90 0.23
91 0.14
92 0.07
93 0.04
94 0.03
95 0.04
96 0.04
97 0.06
98 0.08
99 0.11
100 0.12
101 0.14
102 0.14
103 0.15
104 0.17
105 0.18
106 0.24
107 0.23
108 0.24
109 0.23
110 0.25
111 0.23
112 0.21
113 0.21
114 0.12
115 0.14
116 0.12
117 0.12
118 0.1
119 0.1
120 0.1
121 0.07
122 0.08
123 0.07
124 0.07
125 0.09
126 0.08
127 0.09
128 0.09
129 0.09
130 0.08
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.06
139 0.06
140 0.08
141 0.12
142 0.12
143 0.11
144 0.14
145 0.14
146 0.14
147 0.15
148 0.16
149 0.13
150 0.17
151 0.16
152 0.15
153 0.16
154 0.15
155 0.14
156 0.13
157 0.15
158 0.15
159 0.17
160 0.22
161 0.22
162 0.25
163 0.26
164 0.3
165 0.29
166 0.26
167 0.25
168 0.2
169 0.19
170 0.15
171 0.15
172 0.11
173 0.12
174 0.13
175 0.14
176 0.14
177 0.15
178 0.17
179 0.16
180 0.16
181 0.15
182 0.17
183 0.16
184 0.17
185 0.16
186 0.15
187 0.15
188 0.14
189 0.12
190 0.11
191 0.11
192 0.1
193 0.11
194 0.14
195 0.18
196 0.23
197 0.26
198 0.27
199 0.31
200 0.33
201 0.35
202 0.35
203 0.35
204 0.3
205 0.28
206 0.25
207 0.21
208 0.19
209 0.15
210 0.12
211 0.07
212 0.07
213 0.05
214 0.05
215 0.05
216 0.04
217 0.05
218 0.06
219 0.07
220 0.07
221 0.09
222 0.09
223 0.15
224 0.16
225 0.18
226 0.18
227 0.19
228 0.22
229 0.21
230 0.23
231 0.19
232 0.18
233 0.2
234 0.21
235 0.2
236 0.16
237 0.15
238 0.13
239 0.11
240 0.11
241 0.09
242 0.06
243 0.07
244 0.11
245 0.11
246 0.13
247 0.16
248 0.16
249 0.21
250 0.26
251 0.27
252 0.24
253 0.27
254 0.26
255 0.28
256 0.31
257 0.26
258 0.23
259 0.24
260 0.26
261 0.25
262 0.23
263 0.19
264 0.16
265 0.18
266 0.18
267 0.18
268 0.15
269 0.12
270 0.13
271 0.13
272 0.13
273 0.1
274 0.09
275 0.09
276 0.1
277 0.11
278 0.14
279 0.2
280 0.25
281 0.31
282 0.33
283 0.36
284 0.41
285 0.42
286 0.48
287 0.45
288 0.4
289 0.35
290 0.34
291 0.31
292 0.25
293 0.26
294 0.24
295 0.22
296 0.22
297 0.21
298 0.21
299 0.19
300 0.2
301 0.19
302 0.13
303 0.19
304 0.23
305 0.25
306 0.25
307 0.27
308 0.29
309 0.29
310 0.34
311 0.37
312 0.42
313 0.46
314 0.51
315 0.56
316 0.56
317 0.57
318 0.5
319 0.41
320 0.32
321 0.25
322 0.23
323 0.17
324 0.15
325 0.14
326 0.14
327 0.16
328 0.16
329 0.17
330 0.15
331 0.16
332 0.18
333 0.2