Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TG00

Protein Details
Accession A0A397TG00   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-114SSPPALPLKKNSRKKKTGKISVASHydrophilic
NLS Segment(s)
PositionSequence
99-108KKNSRKKKTG
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 12.666
Family & Domain DBs
Amino Acid Sequences MVRQRMNCNAPPLSPTDYDFIMQRENERPRKKVLDELMAKYNTSMKRIYQIWRGEEANRIAWNQPIADISNTTYAGGCLPVVNYDPPPAISSPPALPLKKNSRKKKTGKISVASTETEVLSQHSANTTDNTDIISKMGSELEEVLKQMDDIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.25
4 0.24
5 0.24
6 0.23
7 0.21
8 0.2
9 0.19
10 0.21
11 0.27
12 0.36
13 0.45
14 0.49
15 0.51
16 0.54
17 0.6
18 0.59
19 0.58
20 0.55
21 0.55
22 0.54
23 0.55
24 0.54
25 0.48
26 0.45
27 0.37
28 0.38
29 0.3
30 0.27
31 0.24
32 0.18
33 0.23
34 0.27
35 0.3
36 0.32
37 0.35
38 0.35
39 0.38
40 0.38
41 0.34
42 0.35
43 0.33
44 0.28
45 0.24
46 0.22
47 0.19
48 0.18
49 0.18
50 0.13
51 0.12
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.1
60 0.09
61 0.08
62 0.07
63 0.07
64 0.06
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.06
71 0.07
72 0.08
73 0.08
74 0.09
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.16
81 0.2
82 0.2
83 0.2
84 0.27
85 0.38
86 0.46
87 0.56
88 0.61
89 0.66
90 0.76
91 0.83
92 0.86
93 0.86
94 0.87
95 0.85
96 0.8
97 0.75
98 0.7
99 0.64
100 0.54
101 0.44
102 0.35
103 0.26
104 0.21
105 0.16
106 0.12
107 0.11
108 0.1
109 0.1
110 0.11
111 0.12
112 0.13
113 0.15
114 0.15
115 0.15
116 0.15
117 0.16
118 0.15
119 0.14
120 0.13
121 0.11
122 0.09
123 0.09
124 0.1
125 0.08
126 0.08
127 0.1
128 0.13
129 0.13
130 0.14
131 0.14
132 0.13