Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SXD3

Protein Details
Accession A0A397SXD3    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
199-218QIPRNIKRIYRRKVAKATKLHydrophilic
NLS Segment(s)
PositionSequence
205-217KRIYRRKVAKATK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MSNEETRLKKYNTNELIKYLRKKDLKLDDDDFTIIRKEKIAGLDFLELTKEEFRSIGFALGPATRLVKFITELKEAKAPLHEQKQSDFKENNDLQTAETNEKIHDPCVNISTTTSERISNETYLPEIASQRLRYYEIWNRPYVNWPCLEEFSKYLHDVTKVRVHNSFKMEIKVLRELFTKDHPAQLRLTHLEAQLKMQQIPRNIKRIYRRKVAKATKLLAKKEIVKEEIEIAKNSVIVNGYHRINKHYEDYHEASTQLVKRNLFDDGINESLATKKLRTAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.62
4 0.64
5 0.66
6 0.62
7 0.62
8 0.6
9 0.6
10 0.64
11 0.66
12 0.63
13 0.62
14 0.6
15 0.53
16 0.5
17 0.49
18 0.39
19 0.3
20 0.28
21 0.22
22 0.19
23 0.18
24 0.17
25 0.19
26 0.24
27 0.26
28 0.23
29 0.24
30 0.26
31 0.25
32 0.24
33 0.21
34 0.16
35 0.15
36 0.16
37 0.14
38 0.11
39 0.11
40 0.11
41 0.13
42 0.13
43 0.13
44 0.1
45 0.1
46 0.11
47 0.12
48 0.12
49 0.1
50 0.12
51 0.1
52 0.11
53 0.11
54 0.11
55 0.12
56 0.17
57 0.2
58 0.24
59 0.25
60 0.26
61 0.29
62 0.29
63 0.28
64 0.26
65 0.26
66 0.27
67 0.34
68 0.37
69 0.34
70 0.38
71 0.45
72 0.44
73 0.48
74 0.42
75 0.35
76 0.41
77 0.41
78 0.39
79 0.33
80 0.31
81 0.24
82 0.26
83 0.27
84 0.19
85 0.19
86 0.17
87 0.15
88 0.18
89 0.18
90 0.15
91 0.15
92 0.15
93 0.15
94 0.16
95 0.17
96 0.14
97 0.14
98 0.16
99 0.15
100 0.16
101 0.16
102 0.15
103 0.15
104 0.18
105 0.19
106 0.16
107 0.16
108 0.14
109 0.13
110 0.12
111 0.12
112 0.1
113 0.09
114 0.09
115 0.11
116 0.12
117 0.12
118 0.13
119 0.15
120 0.15
121 0.2
122 0.26
123 0.31
124 0.34
125 0.35
126 0.35
127 0.33
128 0.41
129 0.38
130 0.32
131 0.25
132 0.24
133 0.24
134 0.25
135 0.26
136 0.18
137 0.17
138 0.18
139 0.18
140 0.17
141 0.16
142 0.15
143 0.17
144 0.17
145 0.19
146 0.24
147 0.23
148 0.25
149 0.3
150 0.32
151 0.34
152 0.37
153 0.38
154 0.32
155 0.32
156 0.32
157 0.29
158 0.29
159 0.3
160 0.26
161 0.23
162 0.23
163 0.23
164 0.23
165 0.25
166 0.28
167 0.23
168 0.28
169 0.28
170 0.28
171 0.29
172 0.28
173 0.29
174 0.24
175 0.26
176 0.24
177 0.24
178 0.26
179 0.25
180 0.26
181 0.26
182 0.25
183 0.25
184 0.26
185 0.28
186 0.31
187 0.41
188 0.43
189 0.47
190 0.47
191 0.51
192 0.57
193 0.64
194 0.65
195 0.65
196 0.68
197 0.69
198 0.78
199 0.81
200 0.8
201 0.77
202 0.75
203 0.73
204 0.72
205 0.66
206 0.6
207 0.55
208 0.53
209 0.51
210 0.52
211 0.45
212 0.39
213 0.38
214 0.39
215 0.4
216 0.35
217 0.29
218 0.25
219 0.23
220 0.23
221 0.22
222 0.18
223 0.13
224 0.12
225 0.15
226 0.18
227 0.21
228 0.24
229 0.25
230 0.27
231 0.3
232 0.33
233 0.35
234 0.35
235 0.37
236 0.41
237 0.44
238 0.44
239 0.41
240 0.38
241 0.33
242 0.34
243 0.34
244 0.34
245 0.34
246 0.32
247 0.32
248 0.33
249 0.35
250 0.3
251 0.26
252 0.21
253 0.22
254 0.22
255 0.21
256 0.19
257 0.17
258 0.19
259 0.22
260 0.21
261 0.16