Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SHZ3

Protein Details
Accession A0A397SHZ3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
122-141KTKAFKWYLKLANKNRKRAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MSRLAYNYYNGYSVIMDKKKAFELNLKSAEGGYKDASYYVGNCYFDGTGILKGEIKAFEWYLKAAEKGEAYCQYLVAIYYNDGKYIPKNKEKGFYWNRKAAINGIIEAQYNIAKYYLDNKNKTKAFKWYLKLANKNRKRAIYLVAKFHRDGIGTRRNLHEAAIWFKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.27
4 0.27
5 0.3
6 0.33
7 0.35
8 0.34
9 0.34
10 0.38
11 0.44
12 0.46
13 0.44
14 0.4
15 0.38
16 0.37
17 0.29
18 0.24
19 0.17
20 0.13
21 0.13
22 0.13
23 0.14
24 0.12
25 0.12
26 0.14
27 0.16
28 0.16
29 0.16
30 0.17
31 0.16
32 0.15
33 0.16
34 0.13
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.12
41 0.11
42 0.11
43 0.11
44 0.11
45 0.12
46 0.11
47 0.11
48 0.12
49 0.12
50 0.11
51 0.1
52 0.11
53 0.11
54 0.11
55 0.14
56 0.14
57 0.15
58 0.14
59 0.13
60 0.12
61 0.11
62 0.11
63 0.08
64 0.06
65 0.06
66 0.09
67 0.09
68 0.09
69 0.1
70 0.1
71 0.13
72 0.2
73 0.25
74 0.28
75 0.33
76 0.34
77 0.41
78 0.42
79 0.49
80 0.51
81 0.55
82 0.55
83 0.56
84 0.55
85 0.5
86 0.49
87 0.4
88 0.36
89 0.26
90 0.21
91 0.16
92 0.15
93 0.14
94 0.13
95 0.12
96 0.08
97 0.08
98 0.07
99 0.07
100 0.06
101 0.07
102 0.15
103 0.23
104 0.3
105 0.36
106 0.39
107 0.48
108 0.52
109 0.56
110 0.5
111 0.51
112 0.52
113 0.54
114 0.55
115 0.55
116 0.6
117 0.65
118 0.72
119 0.73
120 0.76
121 0.76
122 0.81
123 0.79
124 0.75
125 0.7
126 0.64
127 0.62
128 0.61
129 0.58
130 0.59
131 0.58
132 0.56
133 0.53
134 0.52
135 0.45
136 0.36
137 0.34
138 0.32
139 0.36
140 0.36
141 0.4
142 0.41
143 0.43
144 0.42
145 0.39
146 0.36
147 0.31
148 0.36