Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SBB6

Protein Details
Accession A0A397SBB6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-66ENPISRTPRRRQEPVKDPKKPKKPKGPQKPPERFPIBasic
NLS Segment(s)
PositionSequence
37-63TPRRRQEPVKDPKKPKKPKGPQKPPER
Subcellular Location(s) mito 7, plas 4, extr 4, E.R. 4, golg 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MSYIGFKYRIFIALVVIFVTFNFAHPTYDLENPISRTPRRRQEPVKDPKKPKKPKGPQKPPERFPIPNAGAAPDAGGPVGSAPPDAGGPPGGAPPSPAGVGENFVEIYGCSDGTMKKRLEMGKCGRWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.11
5 0.09
6 0.12
7 0.09
8 0.09
9 0.12
10 0.12
11 0.13
12 0.13
13 0.17
14 0.17
15 0.2
16 0.2
17 0.19
18 0.21
19 0.23
20 0.27
21 0.29
22 0.29
23 0.35
24 0.41
25 0.49
26 0.54
27 0.6
28 0.65
29 0.7
30 0.77
31 0.8
32 0.82
33 0.82
34 0.85
35 0.86
36 0.88
37 0.88
38 0.87
39 0.88
40 0.88
41 0.89
42 0.91
43 0.92
44 0.9
45 0.91
46 0.91
47 0.82
48 0.8
49 0.74
50 0.63
51 0.54
52 0.54
53 0.44
54 0.37
55 0.34
56 0.27
57 0.22
58 0.2
59 0.18
60 0.09
61 0.08
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.04
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.11
88 0.1
89 0.1
90 0.09
91 0.09
92 0.09
93 0.07
94 0.1
95 0.08
96 0.08
97 0.07
98 0.09
99 0.13
100 0.17
101 0.24
102 0.23
103 0.24
104 0.31
105 0.37
106 0.41
107 0.47
108 0.52