Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S5T4

Protein Details
Accession A0A397S5T4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-88SFSPNKSKEELKKRYKEKLDKARRNERGGBasic
NLS Segment(s)
PositionSequence
64-88NKSKEELKKRYKEKLDKARRNERGG
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MNLTCQYCNMKYCMTHRHPEAHSPKCVEKARNVAHSNFKQESIRVITQERRNPGSTNAKSFSPNKSKEELKKRYKEKLDKARRNERGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.48
4 0.53
5 0.52
6 0.58
7 0.61
8 0.57
9 0.56
10 0.53
11 0.52
12 0.52
13 0.56
14 0.48
15 0.45
16 0.48
17 0.48
18 0.52
19 0.52
20 0.47
21 0.51
22 0.51
23 0.52
24 0.43
25 0.4
26 0.32
27 0.29
28 0.29
29 0.25
30 0.24
31 0.19
32 0.2
33 0.25
34 0.31
35 0.35
36 0.35
37 0.34
38 0.35
39 0.34
40 0.38
41 0.42
42 0.39
43 0.4
44 0.38
45 0.36
46 0.38
47 0.4
48 0.42
49 0.41
50 0.43
51 0.42
52 0.45
53 0.51
54 0.57
55 0.66
56 0.67
57 0.68
58 0.73
59 0.77
60 0.82
61 0.85
62 0.85
63 0.85
64 0.86
65 0.87
66 0.87
67 0.9
68 0.91