Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TC74

Protein Details
Accession A0A397TC74    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
36-55RWWDRVNKGKQWKDIKDRYVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 3, extr 3, nucl 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences SRGLYRSFFRRNSVFLTGIFATAFAFEMTFDTITDRWWDRVNKGKQWKDIKDRYVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.31
3 0.33
4 0.27
5 0.24
6 0.21
7 0.15
8 0.11
9 0.1
10 0.1
11 0.05
12 0.04
13 0.04
14 0.05
15 0.05
16 0.05
17 0.05
18 0.07
19 0.07
20 0.07
21 0.11
22 0.12
23 0.12
24 0.18
25 0.2
26 0.23
27 0.34
28 0.4
29 0.46
30 0.55
31 0.61
32 0.65
33 0.73
34 0.77
35 0.78
36 0.8