Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SL83

Protein Details
Accession A0A397SL83   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-45SRILKSAIKKKKKFNIPNTRLLVHydrophilic
NLS Segment(s)
PositionSequence
29-35AIKKKKK
Subcellular Location(s) mito 11.5, nucl 9, cyto_mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Amino Acid Sequences MDSSLTPYSVEFFKVITTIRVGSRILKSAIKKKKKFNIPNTRLLVGADEMNSPVRSFANIDLLGWDYNSHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.11
4 0.12
5 0.13
6 0.13
7 0.15
8 0.15
9 0.18
10 0.19
11 0.21
12 0.21
13 0.23
14 0.27
15 0.35
16 0.44
17 0.51
18 0.55
19 0.61
20 0.68
21 0.74
22 0.79
23 0.81
24 0.82
25 0.77
26 0.81
27 0.75
28 0.67
29 0.56
30 0.47
31 0.37
32 0.26
33 0.21
34 0.12
35 0.09
36 0.09
37 0.11
38 0.11
39 0.1
40 0.1
41 0.09
42 0.1
43 0.11
44 0.12
45 0.17
46 0.17
47 0.17
48 0.18
49 0.2
50 0.19
51 0.17