Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SQV7

Protein Details
Accession A0A397SQV7   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
103-133KYKVNYALKRIKIKCRSRKDKDEWKSRAKTLHydrophilic
NLS Segment(s)
PositionSequence
114-124KIKCRSRKDKD
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTEMSSLQRPQIKTTSISFSISSKNILPETSINQQILQSPLTYNFKDDNISSPTNKKQKSNTLSSIFSFSRSNSHYRSETYQENYEFNKGCFGFLNTLGSKIKYKVNYALKRIKIKCRSRKDKDEWKSRAKTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.36
4 0.36
5 0.32
6 0.29
7 0.31
8 0.28
9 0.27
10 0.21
11 0.23
12 0.21
13 0.2
14 0.2
15 0.18
16 0.22
17 0.25
18 0.26
19 0.24
20 0.23
21 0.24
22 0.24
23 0.23
24 0.19
25 0.14
26 0.12
27 0.16
28 0.19
29 0.19
30 0.19
31 0.19
32 0.19
33 0.2
34 0.19
35 0.19
36 0.2
37 0.22
38 0.22
39 0.25
40 0.32
41 0.38
42 0.4
43 0.4
44 0.41
45 0.48
46 0.52
47 0.54
48 0.53
49 0.49
50 0.48
51 0.45
52 0.43
53 0.34
54 0.3
55 0.24
56 0.17
57 0.17
58 0.18
59 0.21
60 0.18
61 0.22
62 0.22
63 0.24
64 0.27
65 0.27
66 0.29
67 0.3
68 0.32
69 0.29
70 0.3
71 0.29
72 0.3
73 0.27
74 0.23
75 0.25
76 0.2
77 0.19
78 0.18
79 0.19
80 0.17
81 0.17
82 0.22
83 0.17
84 0.19
85 0.2
86 0.21
87 0.21
88 0.21
89 0.26
90 0.23
91 0.26
92 0.33
93 0.42
94 0.48
95 0.54
96 0.61
97 0.63
98 0.7
99 0.73
100 0.74
101 0.74
102 0.78
103 0.8
104 0.82
105 0.86
106 0.86
107 0.91
108 0.9
109 0.91
110 0.91
111 0.91
112 0.88
113 0.87