Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SBT4

Protein Details
Accession A0A397SBT4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-103FARRTNISKNGRLKKDRKKTKGRTKAKGIBasic
NLS Segment(s)
PositionSequence
61-103KPRKAHRSEVRRVKFARRTNISKNGRLKKDRKKTKGRTKAKGI
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MYYNKQSGNDPVEVRYKTEVEEILNGNHPSLTPKVLNCSLNLGDLDNEEEAAPFDEITEEKPRKAHRSEVRRVKFARRTNISKNGRLKKDRKKTKGRTKAKGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.29
4 0.26
5 0.27
6 0.25
7 0.19
8 0.22
9 0.21
10 0.2
11 0.24
12 0.23
13 0.2
14 0.19
15 0.17
16 0.16
17 0.16
18 0.17
19 0.14
20 0.14
21 0.2
22 0.24
23 0.24
24 0.22
25 0.25
26 0.22
27 0.21
28 0.21
29 0.16
30 0.11
31 0.11
32 0.12
33 0.07
34 0.07
35 0.06
36 0.06
37 0.05
38 0.06
39 0.06
40 0.04
41 0.04
42 0.05
43 0.05
44 0.08
45 0.16
46 0.16
47 0.16
48 0.2
49 0.24
50 0.3
51 0.33
52 0.4
53 0.41
54 0.5
55 0.59
56 0.67
57 0.68
58 0.69
59 0.7
60 0.7
61 0.7
62 0.67
63 0.67
64 0.65
65 0.67
66 0.68
67 0.76
68 0.73
69 0.72
70 0.75
71 0.74
72 0.76
73 0.78
74 0.8
75 0.8
76 0.85
77 0.88
78 0.88
79 0.89
80 0.91
81 0.93
82 0.94
83 0.94