Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397T4S8

Protein Details
Accession A0A397T4S8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-73QIKLGNYRGKRRSQKPNPLPIRAPHydrophilic
NLS Segment(s)
PositionSequence
58-76GKRRSQKPNPLPIRAPSPK
Subcellular Location(s) nucl 13.5, cyto_nucl 13, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MVSIKGQEIPNNKNIFIALTYIYGIGRQRAEEIVKECELRNEIKQIIDAQIKLGNYRGKRRSQKPNPLPIRAPSPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.23
4 0.19
5 0.12
6 0.1
7 0.1
8 0.1
9 0.1
10 0.1
11 0.1
12 0.11
13 0.1
14 0.1
15 0.11
16 0.12
17 0.14
18 0.15
19 0.17
20 0.18
21 0.18
22 0.19
23 0.18
24 0.17
25 0.18
26 0.17
27 0.16
28 0.16
29 0.16
30 0.15
31 0.16
32 0.16
33 0.18
34 0.18
35 0.17
36 0.15
37 0.16
38 0.16
39 0.16
40 0.19
41 0.21
42 0.23
43 0.32
44 0.38
45 0.45
46 0.55
47 0.64
48 0.71
49 0.76
50 0.84
51 0.84
52 0.89
53 0.87
54 0.85
55 0.8
56 0.73