Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SIH9

Protein Details
Accession A0A397SIH9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
23-44HENCYIKRKKPWCKECVPRYIIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.333, nucl 9, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFKSLLNKFKISNISDNSVIINHENCYIKRKKPWCKECVPRYIIKGWTSGNHDIDDFIKDTIYSAKINYDDVKYYNYPLFLEWVPFDRFKDIKQIGERGFAKVYSATWIDGKAEYYRQNDGSWKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.41
4 0.35
5 0.29
6 0.26
7 0.19
8 0.17
9 0.13
10 0.17
11 0.2
12 0.19
13 0.27
14 0.32
15 0.35
16 0.44
17 0.53
18 0.59
19 0.67
20 0.76
21 0.76
22 0.8
23 0.85
24 0.83
25 0.83
26 0.76
27 0.69
28 0.63
29 0.59
30 0.54
31 0.44
32 0.39
33 0.3
34 0.29
35 0.31
36 0.31
37 0.28
38 0.24
39 0.23
40 0.21
41 0.2
42 0.18
43 0.13
44 0.09
45 0.08
46 0.07
47 0.07
48 0.08
49 0.09
50 0.08
51 0.07
52 0.09
53 0.1
54 0.11
55 0.12
56 0.12
57 0.11
58 0.12
59 0.16
60 0.14
61 0.16
62 0.16
63 0.15
64 0.14
65 0.13
66 0.15
67 0.12
68 0.12
69 0.11
70 0.14
71 0.16
72 0.17
73 0.17
74 0.19
75 0.2
76 0.19
77 0.29
78 0.27
79 0.3
80 0.34
81 0.4
82 0.36
83 0.44
84 0.44
85 0.37
86 0.36
87 0.3
88 0.27
89 0.21
90 0.2
91 0.16
92 0.16
93 0.14
94 0.14
95 0.15
96 0.15
97 0.15
98 0.17
99 0.16
100 0.2
101 0.24
102 0.27
103 0.31
104 0.31
105 0.33
106 0.39