Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SW65

Protein Details
Accession A0A397SW65    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-158KQLKSACETNKRKRKRGDDDFDYHydrophilic
NLS Segment(s)
PositionSequence
147-150RKRK
Subcellular Location(s) nucl 16.5, mito_nucl 11.999, cyto_nucl 11.666, mito 6, cyto_mito 5.999
Family & Domain DBs
Amino Acid Sequences MGRDFLKTSKEEFEHYGMLGGPAKRLADFAKECKDKELKAFSSYLSLSEVLAEYGLDSDDSLEAMRNEYVVALLHASIHIVMDETNKELSMRPQYGIVGEESKGRVYYAIKEAKDLICIMEDKQHKVPVGFAQNIKQLKSACETNKRKRKRGDDDFDYLYGFVTTGRDWHFLLYSPGKISKASDTVYSIEFTKKALDLNSNSYKSLCNSVKEILGIIVGLLKDRACAEEEPDRKRARIEEYHLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.22
5 0.22
6 0.23
7 0.19
8 0.16
9 0.17
10 0.17
11 0.16
12 0.17
13 0.17
14 0.21
15 0.25
16 0.3
17 0.39
18 0.42
19 0.43
20 0.48
21 0.51
22 0.45
23 0.48
24 0.51
25 0.43
26 0.43
27 0.43
28 0.36
29 0.36
30 0.34
31 0.27
32 0.2
33 0.17
34 0.14
35 0.14
36 0.13
37 0.09
38 0.08
39 0.07
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.08
52 0.08
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.06
70 0.06
71 0.08
72 0.08
73 0.08
74 0.08
75 0.09
76 0.13
77 0.18
78 0.18
79 0.18
80 0.18
81 0.18
82 0.19
83 0.19
84 0.16
85 0.11
86 0.1
87 0.11
88 0.11
89 0.11
90 0.11
91 0.1
92 0.1
93 0.09
94 0.12
95 0.17
96 0.23
97 0.22
98 0.23
99 0.25
100 0.24
101 0.24
102 0.2
103 0.13
104 0.09
105 0.1
106 0.09
107 0.14
108 0.15
109 0.17
110 0.19
111 0.21
112 0.2
113 0.2
114 0.21
115 0.19
116 0.22
117 0.22
118 0.21
119 0.21
120 0.26
121 0.27
122 0.26
123 0.24
124 0.2
125 0.19
126 0.21
127 0.25
128 0.24
129 0.34
130 0.43
131 0.51
132 0.6
133 0.67
134 0.72
135 0.75
136 0.81
137 0.81
138 0.82
139 0.81
140 0.77
141 0.74
142 0.69
143 0.6
144 0.5
145 0.39
146 0.28
147 0.19
148 0.13
149 0.08
150 0.06
151 0.05
152 0.08
153 0.1
154 0.12
155 0.12
156 0.13
157 0.13
158 0.13
159 0.18
160 0.18
161 0.17
162 0.18
163 0.2
164 0.19
165 0.19
166 0.2
167 0.19
168 0.2
169 0.2
170 0.19
171 0.19
172 0.2
173 0.21
174 0.2
175 0.18
176 0.16
177 0.15
178 0.14
179 0.14
180 0.13
181 0.14
182 0.15
183 0.2
184 0.21
185 0.29
186 0.37
187 0.37
188 0.36
189 0.35
190 0.35
191 0.31
192 0.37
193 0.32
194 0.27
195 0.28
196 0.3
197 0.31
198 0.29
199 0.28
200 0.19
201 0.16
202 0.13
203 0.09
204 0.09
205 0.07
206 0.08
207 0.08
208 0.08
209 0.09
210 0.09
211 0.11
212 0.12
213 0.13
214 0.18
215 0.26
216 0.33
217 0.37
218 0.45
219 0.47
220 0.45
221 0.48
222 0.48
223 0.46
224 0.49
225 0.52