Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T1V3

Protein Details
Accession A0A397T1V3   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-45LALIKPKKRYRHTTTLVGKRLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, cyto 3.5, cyto_pero 3, nucl 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011043  Gal_Oxase/kelch_b-propeller  
IPR015915  Kelch-typ_b-propeller  
IPR006652  Kelch_1  
Pfam View protein in Pfam  
PF01344  Kelch_1  
Amino Acid Sequences MIKNTSIYIVLWFLFQLFAEVNSQLALIKPKKRYRHTTTLVGKRLYVLGGIGDDPNTGKQFFYLDVSIPFNAKELLWQDSTSTNIVPSHDDAASVTGGANNNTLILYSGSLDATKPLIYTLDAQNNLWSNPKLNVINIERKVQLTGVADYNGKMYLFGGMLSNVDNVMLNDMLIFDTVNLNWGKGSVVNAPTQRRNYGATLLPNGKIIYIGGINGDHLPLNEVYLYDTINDAWSNQVSLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.07
5 0.08
6 0.1
7 0.1
8 0.1
9 0.1
10 0.1
11 0.08
12 0.1
13 0.17
14 0.22
15 0.29
16 0.38
17 0.47
18 0.57
19 0.65
20 0.74
21 0.74
22 0.79
23 0.78
24 0.79
25 0.81
26 0.81
27 0.79
28 0.7
29 0.6
30 0.51
31 0.45
32 0.35
33 0.25
34 0.15
35 0.09
36 0.09
37 0.09
38 0.08
39 0.07
40 0.07
41 0.08
42 0.1
43 0.11
44 0.11
45 0.1
46 0.1
47 0.11
48 0.12
49 0.14
50 0.12
51 0.12
52 0.14
53 0.16
54 0.16
55 0.15
56 0.14
57 0.12
58 0.12
59 0.1
60 0.11
61 0.11
62 0.14
63 0.14
64 0.14
65 0.15
66 0.15
67 0.17
68 0.15
69 0.13
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.13
76 0.12
77 0.12
78 0.11
79 0.11
80 0.1
81 0.09
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.06
88 0.07
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.06
106 0.08
107 0.11
108 0.14
109 0.15
110 0.15
111 0.17
112 0.17
113 0.17
114 0.17
115 0.14
116 0.11
117 0.12
118 0.16
119 0.14
120 0.14
121 0.19
122 0.21
123 0.29
124 0.29
125 0.3
126 0.27
127 0.27
128 0.28
129 0.22
130 0.2
131 0.14
132 0.14
133 0.13
134 0.13
135 0.13
136 0.13
137 0.13
138 0.11
139 0.09
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.05
164 0.05
165 0.09
166 0.09
167 0.09
168 0.09
169 0.09
170 0.09
171 0.09
172 0.12
173 0.13
174 0.15
175 0.19
176 0.24
177 0.3
178 0.36
179 0.38
180 0.38
181 0.35
182 0.36
183 0.34
184 0.34
185 0.33
186 0.31
187 0.34
188 0.35
189 0.33
190 0.32
191 0.3
192 0.25
193 0.21
194 0.17
195 0.12
196 0.1
197 0.09
198 0.08
199 0.08
200 0.1
201 0.1
202 0.1
203 0.08
204 0.08
205 0.11
206 0.1
207 0.11
208 0.1
209 0.1
210 0.11
211 0.12
212 0.12
213 0.09
214 0.1
215 0.1
216 0.11
217 0.11
218 0.1
219 0.12
220 0.13
221 0.13