Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397THL9

Protein Details
Accession A0A397THL9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
133-157ISPNPLTEKPIRRKKRIPEICPLSFHydrophilic
NLS Segment(s)
PositionSequence
143-148IRRKKR
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MRRGGSMVPPFFIWIFQDYPEVAAYFLRTLNPVILNVAYDKLSGMFLSFAVDLLLDYTFPNNWIKGIIKKAVVFSYNKYVIPIIFSSKLPIILRRRGLTPEEMLEPAEFAILEKEDIPGKDYLENEKKMHLLISPNPLTEKPIRRKKRIPEICPLSFWKKQLAKGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.17
5 0.15
6 0.16
7 0.17
8 0.15
9 0.12
10 0.11
11 0.11
12 0.1
13 0.11
14 0.1
15 0.1
16 0.11
17 0.13
18 0.13
19 0.13
20 0.13
21 0.12
22 0.12
23 0.12
24 0.12
25 0.1
26 0.09
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.06
33 0.05
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.11
52 0.15
53 0.18
54 0.19
55 0.2
56 0.21
57 0.22
58 0.22
59 0.22
60 0.19
61 0.18
62 0.22
63 0.22
64 0.21
65 0.2
66 0.19
67 0.16
68 0.17
69 0.15
70 0.11
71 0.11
72 0.11
73 0.12
74 0.12
75 0.15
76 0.13
77 0.19
78 0.21
79 0.25
80 0.29
81 0.29
82 0.3
83 0.3
84 0.32
85 0.28
86 0.24
87 0.21
88 0.19
89 0.18
90 0.17
91 0.14
92 0.12
93 0.1
94 0.08
95 0.06
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.07
102 0.09
103 0.09
104 0.11
105 0.11
106 0.12
107 0.15
108 0.16
109 0.23
110 0.29
111 0.32
112 0.31
113 0.32
114 0.31
115 0.29
116 0.28
117 0.22
118 0.2
119 0.21
120 0.29
121 0.29
122 0.29
123 0.31
124 0.3
125 0.33
126 0.36
127 0.41
128 0.43
129 0.52
130 0.61
131 0.68
132 0.77
133 0.83
134 0.86
135 0.87
136 0.82
137 0.82
138 0.81
139 0.75
140 0.71
141 0.67
142 0.63
143 0.57
144 0.53
145 0.52
146 0.48
147 0.53