Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T6W4

Protein Details
Accession A0A397T6W4    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-30LTEGSKIYAKKRKNRIEQVPEVVFHydrophilic
39-58LTGFHKRKLERKAKAKESALHydrophilic
182-223KSTITSKKSEKAEKVNKKKRQPRNKTRRSKTKKSKSGLKRRKBasic
NLS Segment(s)
PositionSequence
43-77HKRKLERKAKAKESALQFSKQERAKARKAAKESVK
187-223SKKSEKAEKVNKKKRQPRNKTRRSKTKKSKSGLKRRK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MDNLTVLTEGSKIYAKKRKNRIEQVPEVVFDETARREFLTGFHKRKLERKAKAKESALQFSKQERAKARKAAKESVKEQIKQRLAKLQDAINKRNGIIGCESEKEEEETNNSDNEKNNNKEPNVIQTEFRSPDNTKTTVTIIEDFNISDTLGNVSKKPRIDEEVISRNKEISSVPIKKSEQKSTITSKKSEKAEKVNKKKRQPRNKTRRSKTKKSKSGLKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.5
4 0.61
5 0.69
6 0.76
7 0.85
8 0.86
9 0.88
10 0.87
11 0.85
12 0.77
13 0.67
14 0.58
15 0.48
16 0.37
17 0.28
18 0.23
19 0.17
20 0.16
21 0.16
22 0.14
23 0.14
24 0.14
25 0.18
26 0.24
27 0.31
28 0.35
29 0.4
30 0.44
31 0.47
32 0.55
33 0.61
34 0.62
35 0.62
36 0.68
37 0.73
38 0.76
39 0.81
40 0.77
41 0.73
42 0.69
43 0.68
44 0.61
45 0.53
46 0.47
47 0.42
48 0.46
49 0.42
50 0.41
51 0.41
52 0.45
53 0.49
54 0.55
55 0.6
56 0.59
57 0.62
58 0.64
59 0.64
60 0.63
61 0.6
62 0.6
63 0.58
64 0.55
65 0.55
66 0.55
67 0.54
68 0.5
69 0.49
70 0.47
71 0.43
72 0.43
73 0.4
74 0.35
75 0.36
76 0.38
77 0.39
78 0.37
79 0.35
80 0.32
81 0.33
82 0.29
83 0.23
84 0.19
85 0.19
86 0.15
87 0.16
88 0.17
89 0.14
90 0.14
91 0.14
92 0.13
93 0.11
94 0.11
95 0.12
96 0.12
97 0.13
98 0.13
99 0.13
100 0.14
101 0.19
102 0.23
103 0.24
104 0.28
105 0.32
106 0.31
107 0.33
108 0.32
109 0.34
110 0.34
111 0.32
112 0.28
113 0.26
114 0.3
115 0.28
116 0.28
117 0.25
118 0.2
119 0.25
120 0.28
121 0.28
122 0.24
123 0.24
124 0.24
125 0.22
126 0.22
127 0.18
128 0.14
129 0.14
130 0.13
131 0.12
132 0.11
133 0.1
134 0.08
135 0.06
136 0.06
137 0.08
138 0.1
139 0.11
140 0.12
141 0.15
142 0.19
143 0.21
144 0.23
145 0.24
146 0.27
147 0.3
148 0.33
149 0.38
150 0.44
151 0.46
152 0.46
153 0.43
154 0.38
155 0.34
156 0.3
157 0.23
158 0.2
159 0.26
160 0.3
161 0.32
162 0.39
163 0.41
164 0.49
165 0.55
166 0.57
167 0.52
168 0.5
169 0.53
170 0.56
171 0.62
172 0.58
173 0.57
174 0.56
175 0.58
176 0.62
177 0.65
178 0.62
179 0.64
180 0.71
181 0.76
182 0.81
183 0.84
184 0.86
185 0.88
186 0.91
187 0.92
188 0.92
189 0.92
190 0.92
191 0.93
192 0.95
193 0.95
194 0.96
195 0.96
196 0.95
197 0.95
198 0.95
199 0.95
200 0.94
201 0.92
202 0.91
203 0.91