Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S2Q1

Protein Details
Accession A0A397S2Q1    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-64IEDKKKANKKKAMSKKKQENLNQKCSHydrophilic
67-86RSSYDERRVRRNKNDEIENVHydrophilic
NLS Segment(s)
PositionSequence
41-55DKKKANKKKAMSKKK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MYNKLVAKNKCQYIEVDYNQGLDDTKKSNELFFLLKKLIEDKKKANKKKAMSKKKQENLNQKCSLSRSSYDERRVRRNKNDEIENVCYFALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.45
3 0.42
4 0.36
5 0.34
6 0.32
7 0.31
8 0.23
9 0.15
10 0.16
11 0.13
12 0.13
13 0.17
14 0.17
15 0.17
16 0.18
17 0.18
18 0.19
19 0.18
20 0.2
21 0.16
22 0.16
23 0.16
24 0.2
25 0.25
26 0.26
27 0.29
28 0.34
29 0.44
30 0.53
31 0.6
32 0.64
33 0.65
34 0.68
35 0.74
36 0.77
37 0.79
38 0.79
39 0.82
40 0.84
41 0.83
42 0.85
43 0.83
44 0.83
45 0.81
46 0.8
47 0.74
48 0.64
49 0.59
50 0.53
51 0.48
52 0.4
53 0.34
54 0.32
55 0.36
56 0.42
57 0.49
58 0.54
59 0.56
60 0.63
61 0.7
62 0.72
63 0.75
64 0.76
65 0.76
66 0.78
67 0.8
68 0.76
69 0.74
70 0.71
71 0.62
72 0.54