Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T1R2

Protein Details
Accession A0A397T1R2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
211-240KMKQDENISKKKKKSAKKKELKAENLLIKGHydrophilic
NLS Segment(s)
PositionSequence
219-232SKKKKKSAKKKELK
Subcellular Location(s) nucl 15, mito_nucl 12.999, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000999  RNase_III_dom  
IPR036389  RNase_III_sf  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
PROSITE View protein in PROSITE  
PS50142  RNASE_3_2  
Amino Acid Sequences MFRFQQNFKNLKYNDFVTLQQQNQLSFRSSFNSRLLPSASYSTKRITLPEINNEKLRTLIFKNDKFYRFYGDKAYNYYAVRALNLKLTEANNPTFNTITQKLISREFLTEVAKVCELDKMLSLHSNNNLHLGEMMEAYCSGMLFNGMEEEMKKFASEVVDYYFMKENINLKKVIVNEQQKGVKMKQDEINSKNITNKVVQENNKEQQKEVKMKQDENISKKKKKSAKKKELKAENLLIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.38
4 0.35
5 0.41
6 0.37
7 0.37
8 0.36
9 0.34
10 0.33
11 0.34
12 0.3
13 0.25
14 0.25
15 0.25
16 0.26
17 0.28
18 0.3
19 0.33
20 0.31
21 0.32
22 0.33
23 0.29
24 0.28
25 0.3
26 0.3
27 0.28
28 0.3
29 0.29
30 0.31
31 0.31
32 0.3
33 0.3
34 0.35
35 0.36
36 0.44
37 0.48
38 0.47
39 0.51
40 0.5
41 0.44
42 0.37
43 0.32
44 0.27
45 0.22
46 0.28
47 0.33
48 0.36
49 0.43
50 0.49
51 0.5
52 0.49
53 0.48
54 0.46
55 0.39
56 0.36
57 0.37
58 0.36
59 0.35
60 0.36
61 0.37
62 0.34
63 0.32
64 0.31
65 0.26
66 0.2
67 0.2
68 0.17
69 0.15
70 0.15
71 0.15
72 0.15
73 0.15
74 0.16
75 0.19
76 0.2
77 0.21
78 0.2
79 0.2
80 0.21
81 0.19
82 0.18
83 0.19
84 0.18
85 0.18
86 0.17
87 0.2
88 0.2
89 0.22
90 0.23
91 0.19
92 0.18
93 0.17
94 0.18
95 0.16
96 0.15
97 0.14
98 0.13
99 0.12
100 0.12
101 0.11
102 0.1
103 0.09
104 0.08
105 0.09
106 0.08
107 0.08
108 0.11
109 0.11
110 0.12
111 0.16
112 0.17
113 0.15
114 0.17
115 0.17
116 0.14
117 0.14
118 0.13
119 0.09
120 0.08
121 0.07
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.05
136 0.06
137 0.07
138 0.07
139 0.07
140 0.06
141 0.08
142 0.09
143 0.09
144 0.09
145 0.11
146 0.14
147 0.14
148 0.17
149 0.19
150 0.17
151 0.17
152 0.19
153 0.23
154 0.25
155 0.28
156 0.25
157 0.23
158 0.26
159 0.27
160 0.32
161 0.34
162 0.35
163 0.35
164 0.4
165 0.43
166 0.43
167 0.46
168 0.4
169 0.37
170 0.33
171 0.36
172 0.37
173 0.42
174 0.47
175 0.45
176 0.52
177 0.49
178 0.48
179 0.48
180 0.44
181 0.38
182 0.33
183 0.35
184 0.35
185 0.41
186 0.44
187 0.47
188 0.54
189 0.59
190 0.64
191 0.59
192 0.53
193 0.53
194 0.57
195 0.58
196 0.56
197 0.58
198 0.57
199 0.59
200 0.63
201 0.65
202 0.64
203 0.63
204 0.68
205 0.68
206 0.69
207 0.73
208 0.78
209 0.76
210 0.79
211 0.82
212 0.83
213 0.84
214 0.87
215 0.91
216 0.92
217 0.94
218 0.9
219 0.88
220 0.85