Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SUY2

Protein Details
Accession A0A397SUY2    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGFLHTKRRNRLKNKKVLDMARHydrophilic
NLS Segment(s)
PositionSequence
8-15RRNRLKNK
Subcellular Location(s) nucl 15, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MGFLHTKRRNRLKNKKVLDMARIRSDILYKRKIKEIEEGQKQVRRLHIAPPILNNQENDSLXEXEDESDYEDEDLNVSDLDDXSEDDNLDEKDDDFHWSEICANWINLIDHEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.79
5 0.77
6 0.75
7 0.7
8 0.65
9 0.58
10 0.49
11 0.41
12 0.41
13 0.4
14 0.38
15 0.42
16 0.41
17 0.43
18 0.5
19 0.51
20 0.49
21 0.5
22 0.52
23 0.53
24 0.55
25 0.57
26 0.54
27 0.55
28 0.55
29 0.48
30 0.42
31 0.37
32 0.3
33 0.31
34 0.33
35 0.33
36 0.31
37 0.32
38 0.33
39 0.3
40 0.3
41 0.25
42 0.21
43 0.21
44 0.2
45 0.19
46 0.16
47 0.15
48 0.14
49 0.13
50 0.12
51 0.09
52 0.09
53 0.08
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.1
77 0.1
78 0.13
79 0.15
80 0.15
81 0.15
82 0.15
83 0.16
84 0.15
85 0.17
86 0.16
87 0.14
88 0.15
89 0.17
90 0.17