Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T205

Protein Details
Accession A0A397T205   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-119NEAKKNKSKPSKTYRTNCKWKVYHydrophilic
163-189GHNRATCPSNPNRKKRRQEQFEPGSLWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MFNDDSDTETFTNEFLNNIPDDSEEEYPFEAIENSNNDLSTLTLILEVGMTFLTWKSAYDHINSNKVFFIRQGRCVKLENERRKQTILCNCEGTYNNEAKKNKSKPSKTYRTNCKWKVYNQDLYKEGHQEPQRFKGPLENSSHSNEVAGERNQNKCGLCNNVGHNRATCPSNPNRKKRRQEQFEPGSLWSPECTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.13
4 0.13
5 0.13
6 0.13
7 0.12
8 0.14
9 0.17
10 0.19
11 0.17
12 0.17
13 0.17
14 0.17
15 0.16
16 0.14
17 0.11
18 0.09
19 0.12
20 0.13
21 0.15
22 0.16
23 0.16
24 0.16
25 0.15
26 0.15
27 0.12
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.09
44 0.13
45 0.15
46 0.17
47 0.25
48 0.27
49 0.34
50 0.33
51 0.32
52 0.3
53 0.28
54 0.26
55 0.21
56 0.28
57 0.23
58 0.32
59 0.36
60 0.37
61 0.39
62 0.41
63 0.4
64 0.4
65 0.48
66 0.49
67 0.53
68 0.56
69 0.56
70 0.55
71 0.54
72 0.52
73 0.5
74 0.44
75 0.37
76 0.35
77 0.33
78 0.34
79 0.34
80 0.3
81 0.25
82 0.25
83 0.25
84 0.28
85 0.29
86 0.3
87 0.38
88 0.4
89 0.45
90 0.51
91 0.55
92 0.59
93 0.68
94 0.74
95 0.74
96 0.78
97 0.8
98 0.8
99 0.85
100 0.81
101 0.78
102 0.73
103 0.69
104 0.7
105 0.66
106 0.65
107 0.58
108 0.57
109 0.51
110 0.48
111 0.45
112 0.39
113 0.33
114 0.31
115 0.33
116 0.35
117 0.37
118 0.41
119 0.45
120 0.41
121 0.4
122 0.41
123 0.4
124 0.4
125 0.44
126 0.4
127 0.37
128 0.4
129 0.42
130 0.33
131 0.3
132 0.24
133 0.19
134 0.2
135 0.19
136 0.22
137 0.25
138 0.29
139 0.3
140 0.33
141 0.31
142 0.29
143 0.33
144 0.32
145 0.31
146 0.33
147 0.38
148 0.43
149 0.46
150 0.45
151 0.42
152 0.38
153 0.38
154 0.35
155 0.31
156 0.3
157 0.37
158 0.46
159 0.55
160 0.63
161 0.71
162 0.79
163 0.87
164 0.9
165 0.92
166 0.9
167 0.91
168 0.91
169 0.89
170 0.85
171 0.77
172 0.69
173 0.62
174 0.52
175 0.43