Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SR62

Protein Details
Accession A0A397SR62    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTPQRREMRSRNDKQPSKKKLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MTPQRREMRSRNDKQPSKKKLLSLLVRISNFVDHKIKLEDGFYVKVMAVKMIKSDVFLEVEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.85
4 0.83
5 0.78
6 0.71
7 0.68
8 0.69
9 0.64
10 0.6
11 0.57
12 0.53
13 0.49
14 0.46
15 0.38
16 0.32
17 0.26
18 0.23
19 0.19
20 0.14
21 0.15
22 0.16
23 0.17
24 0.14
25 0.14
26 0.14
27 0.14
28 0.15
29 0.14
30 0.13
31 0.12
32 0.14
33 0.13
34 0.14
35 0.12
36 0.12
37 0.13
38 0.15
39 0.15
40 0.14
41 0.16
42 0.15
43 0.17