Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SGY4

Protein Details
Accession A0A397SGY4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-57NTHQVKRYKIRDLRKRMKQYIHIYKYFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 13.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MKFKNFDEVLEKFNFHDQKSRSFSFYNNINNTHQVKRYKIRDLRKRMKQYIHIYKYFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.33
4 0.3
5 0.37
6 0.43
7 0.43
8 0.39
9 0.37
10 0.37
11 0.34
12 0.38
13 0.37
14 0.33
15 0.34
16 0.32
17 0.36
18 0.38
19 0.37
20 0.36
21 0.32
22 0.35
23 0.41
24 0.45
25 0.5
26 0.55
27 0.63
28 0.67
29 0.75
30 0.8
31 0.82
32 0.86
33 0.84
34 0.85
35 0.84
36 0.84
37 0.85
38 0.82