Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TCA2

Protein Details
Accession A0A397TCA2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23TLPHIYNKKRPDFREQTKEVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011547  SLC26A/SulP_dom  
IPR001902  SLC26A/SulP_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF00916  Sulfate_transp  
Amino Acid Sequences MSETLPHIYNKKRPDFREQTKEVIQNFPQHSLEYVKSLFPIVGWIGRYNLIWLAGDIIAGLTAGAVVIPQGMAYAKVAMLPPEYGLYSSFVGVSLYFLFATSKDITIGPTAVMSLLLGQNMASILASPDHKFTAIELASSFSLFSGIIALILGLFRLGFVVDFIPAPVIAGFTTGSAITISIGQIAKLMGIPKISSSEASYLVLGKTLAGLPKTQLDAAFGFSFLIYLYAVKYGALYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.78
4 0.81
5 0.76
6 0.73
7 0.71
8 0.73
9 0.64
10 0.61
11 0.54
12 0.52
13 0.5
14 0.47
15 0.41
16 0.35
17 0.34
18 0.32
19 0.3
20 0.25
21 0.24
22 0.2
23 0.19
24 0.19
25 0.17
26 0.12
27 0.13
28 0.11
29 0.12
30 0.13
31 0.13
32 0.14
33 0.15
34 0.15
35 0.14
36 0.13
37 0.12
38 0.1
39 0.09
40 0.1
41 0.09
42 0.08
43 0.07
44 0.06
45 0.05
46 0.05
47 0.04
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.04
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.07
68 0.07
69 0.08
70 0.08
71 0.07
72 0.08
73 0.09
74 0.09
75 0.09
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.09
88 0.09
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.1
95 0.07
96 0.06
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.02
111 0.03
112 0.04
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.08
119 0.08
120 0.13
121 0.11
122 0.11
123 0.1
124 0.12
125 0.12
126 0.12
127 0.11
128 0.05
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.03
147 0.04
148 0.04
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.05
160 0.06
161 0.05
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.08
169 0.08
170 0.07
171 0.08
172 0.08
173 0.08
174 0.09
175 0.1
176 0.08
177 0.09
178 0.09
179 0.1
180 0.13
181 0.13
182 0.13
183 0.14
184 0.15
185 0.16
186 0.16
187 0.16
188 0.14
189 0.14
190 0.13
191 0.11
192 0.09
193 0.09
194 0.1
195 0.12
196 0.12
197 0.13
198 0.14
199 0.17
200 0.19
201 0.19
202 0.18
203 0.18
204 0.18
205 0.21
206 0.2
207 0.16
208 0.15
209 0.13
210 0.13
211 0.1
212 0.1
213 0.06
214 0.06
215 0.07
216 0.08
217 0.08
218 0.08