Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SCM0

Protein Details
Accession A0A397SCM0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-119LGSKRKYKVNYALKRIKVKCRRRKGKAEWKSRBasic
NLS Segment(s)
PositionSequence
93-119KYKVNYALKRIKVKCRRRKGKAEWKSR
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MTEISHLRRPHIKTTSISFLILSKNITLETPINQQILQSPLTYNFQDDNISLPTNKKQKLSSILLFSRSNSHYRSEIYSGCFDFLNTLGSKRKYKVNYALKRIKVKCRRRKGKAEWKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.49
4 0.45
5 0.36
6 0.32
7 0.3
8 0.27
9 0.22
10 0.14
11 0.13
12 0.13
13 0.13
14 0.13
15 0.12
16 0.13
17 0.17
18 0.19
19 0.2
20 0.19
21 0.19
22 0.19
23 0.2
24 0.18
25 0.14
26 0.12
27 0.13
28 0.16
29 0.16
30 0.15
31 0.13
32 0.13
33 0.13
34 0.13
35 0.13
36 0.12
37 0.12
38 0.11
39 0.12
40 0.18
41 0.24
42 0.26
43 0.26
44 0.26
45 0.29
46 0.35
47 0.38
48 0.35
49 0.34
50 0.33
51 0.35
52 0.34
53 0.3
54 0.28
55 0.25
56 0.25
57 0.21
58 0.22
59 0.2
60 0.21
61 0.24
62 0.22
63 0.22
64 0.22
65 0.24
66 0.22
67 0.21
68 0.19
69 0.16
70 0.14
71 0.12
72 0.13
73 0.1
74 0.13
75 0.18
76 0.23
77 0.27
78 0.28
79 0.36
80 0.36
81 0.44
82 0.51
83 0.56
84 0.62
85 0.68
86 0.75
87 0.74
88 0.81
89 0.79
90 0.8
91 0.79
92 0.81
93 0.82
94 0.84
95 0.88
96 0.88
97 0.92
98 0.93
99 0.93