Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S9H8

Protein Details
Accession A0A397S9H8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-91VVRERKAVPYKQRRKARPKKGTQRPQVKIKSEBasic
NLS Segment(s)
PositionSequence
64-84RKAVPYKQRRKARPKKGTQRP
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MERDVGSQKIELEDLDECVDRDTVVDLIHEIVPLLISEKAKGSSYSTDSSEESDSVETFVVRERKAVPYKQRRKARPKKGTQRPQVKIKSELDIFSLFHPLLELLGKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.12
5 0.13
6 0.13
7 0.1
8 0.1
9 0.1
10 0.08
11 0.08
12 0.08
13 0.07
14 0.09
15 0.09
16 0.09
17 0.07
18 0.06
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.09
26 0.1
27 0.11
28 0.12
29 0.13
30 0.14
31 0.17
32 0.18
33 0.18
34 0.19
35 0.19
36 0.2
37 0.18
38 0.15
39 0.12
40 0.11
41 0.09
42 0.08
43 0.08
44 0.06
45 0.05
46 0.09
47 0.12
48 0.11
49 0.13
50 0.14
51 0.21
52 0.27
53 0.33
54 0.4
55 0.48
56 0.58
57 0.67
58 0.74
59 0.77
60 0.84
61 0.88
62 0.89
63 0.89
64 0.9
65 0.91
66 0.93
67 0.93
68 0.92
69 0.92
70 0.88
71 0.88
72 0.85
73 0.79
74 0.75
75 0.67
76 0.63
77 0.54
78 0.48
79 0.41
80 0.34
81 0.3
82 0.24
83 0.24
84 0.18
85 0.15
86 0.15
87 0.12
88 0.11
89 0.12